KEGG   Homo sapiens (human): 51371
Entry
51371             CDS       T01001                                 

Gene name
POMP, C13orf12, HSPC014, PNAS-110, PRAAS2, UMP1
Definition
(RefSeq) proteasome maturation protein
  KO
K11599  proteasome maturation protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Disease
H00790  Keratosis linearis with ichthyosis congenita and sclerosing keratoderma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    51371 (POMP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    51371 (POMP)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Assembling chaperones
    51371 (POMP)
SSDB
Motif
Pfam: UMP1
Other DBs
NCBI-GeneID: 51371
NCBI-ProteinID: NP_057016
OMIM: 613386
HGNC: 20330
Ensembl: ENSG00000132963
Vega: OTTHUMG00000016652
Pharos: Q9Y244(Tbio)
UniProt: Q9Y244
LinkDB
Position
13q12.3
AA seq 141 aa
MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQD
KMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILND
PSQSEVMGEPHLMVEYKLGLL
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaatgccagaggacttggatctgagctaaaggacagtattccagttactgaactttca
gcaagtggaccttttgaaagtcatgatcttcttcggaaaggtttttcttgtgtgaaaaat
gaacttttgcctagtcatccccttgaattatcagaaaaaaatttccagctcaaccaagat
aaaatgaatttttccacactgagaaacattcagggtctatttgctccgctaaaattacag
atggaattcaaggcagtgcagcaggttcagcgtcttccatttctttcaagctcaaatctt
tcactggatgttttgaggggtaatgatgagactattggatttgaggatattcttaatgat
ccatcacaaagcgaagtcatgggagagccacacttgatggtggaatataaacttggttta
ctgtaa

DBGET integrated database retrieval system