KEGG   Homo sapiens (human): 51449
Entry
51449             CDS       T01001                                 
Symbol
PCYOX1, PCL1
Name
(RefSeq) prenylcysteine oxidase 1
  KO
K05906  prenylcysteine oxidase / farnesylcysteine lyase [EC:1.8.3.5 1.8.3.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    51449 (PCYOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.5  prenylcysteine oxidase
     51449 (PCYOX1)
    1.8.3.6  farnesylcysteine lyase
     51449 (PCYOX1)
SSDB
Motif
Pfam: Prenylcys_lyase NAD_binding_8 Amino_oxidase DAO Pyr_redox_2 NAD_binding_9 Thi4 Trp_halogenase
Other DBs
NCBI-GeneID: 51449
NCBI-ProteinID: NP_057381
OMIM: 610995
HGNC: 20588
Ensembl: ENSG00000116005
Pharos: Q9UHG3(Tbio)
UniProt: Q9UHG3
LinkDB
Position
2:70257915..70281185
AA seq 505 aa
MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKD
VKIDLFEREEVGGRLATMMVQGQEYEAGGSVIHPLNLHMKRFVKDLGLSAVQASGGLLGI
YNGETLVFEESNWFIINVIKLVWRYGFQSLRMHMWVEDVLDKFMRIYRYQSHDYAFSSVE
KLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFVGAVSL
SCSDSGLWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEKTKTKYTGNPTKMYEVVYQIG
TETRSDFYDIVLVATPLNRKMSNITFLNFDPPIEEFHQYYQHIVTTLVKGELNTSIFSSR
PIDKFGLNTVLTTDNSDLFINSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILK
LFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYYLNGIECAASAMEMSAIAAHNAALL
AYHRWNGHTDMIDQDGLYEKLKTEL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggggcgcgtcgtcgcggagctcgtctcctcgctgctggggttgtggctgttgctgtgc
agctgcggatgccccgagggcgccgagctgcgtgctccgccagataaaatcgcgattatt
ggagccggaattggtggcacttcagcagcctattacctgcggcagaaatttgggaaagat
gtgaagatagacctgtttgaaagagaagaggtcgggggccgcctggctaccatgatggtg
caggggcaagaatacgaggcaggaggttctgtcatccatcctttaaatctgcacatgaaa
cgttttgtcaaagacctgggtctctctgctgttcaggcctctggtggcctactggggata
tataatggagagactctggtatttgaggagagcaactggttcataattaacgtgattaaa
ttagtttggcgctatggatttcaatccctccgtatgcacatgtgggtagaggacgtgtta
gacaagttcatgaggatctaccgctaccagtctcatgactatgccttcagtagtgtcgaa
aaattacttcatgctctaggaggagatgacttccttggaatgcttaatcgaacacttctt
gaaaccttgcaaaaggccggcttttctgagaagttcctcaatgaaatgattgctcctgtt
atgagggtcaattatggccaaagcacggacatcaatgcctttgtgggggcggtgtcactg
tcctgttctgattctggcctttgggcagtagaaggtggcaataaacttgtttgctcaggg
cttctgcaggcatccaaaagcaatcttatatctggctcagtaatgtacatcgaggagaaa
acaaagaccaagtacacaggaaatccaacaaagatgtatgaagtggtctaccaaattgga
actgagactcgttcagacttctatgacatcgtcttggtggccactccgttgaatcgaaaa
atgtcgaatattacttttctcaactttgatcctccaattgaggaattccatcaatattat
caacatatagtgacaactttagttaagggggaattgaatacatctatctttagctctaga
cccatagataaatttggccttaatacagttttaaccactgataattcagatttgttcatt
aacagtattgggattgtgccctctgtgagagaaaaggaagatcctgagccatcaacagat
ggaacatatgtttggaagatcttttcccaagaaactcttactaaagcacaaattttaaag
ctctttctgtcctatgattatgctgtgaagaagccatggcttgcatatcctcactataag
cccccggagaaatgcccctctatcattctccatgatcgactttattacctcaatggcata
gagtgtgcagcaagtgccatggagatgagtgccattgcagcccacaacgctgcactcctt
gcctatcaccgctggaacgggcacacagacatgattgatcaggatggcttatatgagaaa
cttaaaactgaactatga

DBGET integrated database retrieval system