KEGG   Homo sapiens (human): 51465
Entry
51465             CDS       T01001                                 
Symbol
UBE2J1, CGI-76, HSPC153, HSPC205, HSU93243, NCUBE-1, NCUBE1, UBC6, UBC6E, Ubc6p
Name
(RefSeq) ubiquitin conjugating enzyme E2 J1
  KO
K10578  ubiquitin-conjugating enzyme E2 J1 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51465 (UBE2J1)
   04120 Ubiquitin mediated proteolysis
    51465 (UBE2J1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    51465 (UBE2J1)
   05022 Pathways of neurodegeneration - multiple diseases
    51465 (UBE2J1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51465 (UBE2J1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     51465 (UBE2J1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   51465 (UBE2J1)
SSDB
Motif
Pfam: UQ_con RWD ATPase-cat_bd
Other DBs
NCBI-GeneID: 51465
NCBI-ProteinID: NP_057105
OMIM: 616175
HGNC: 17598
Ensembl: ENSG00000198833
Pharos: Q9Y385(Tbio)
UniProt: Q9Y385
LinkDB
Position
6:complement(89326625..89352722)
AA seq 318 aa
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHG
RIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMP
TKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELA
RQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQP
TQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAA
LIFRRIYLANEYIFDFEL
NT seq 957 nt   +upstreamnt  +downstreamnt
atggagacccgctacaacctgaagagtccggctgttaaacgtttaatgaaagaagcggca
gaattgaaagatccaacagatcattaccatgcgcagcctttagaggataacctttttgaa
tggcacttcacggttagagggcccccagactccgattttgatggaggagtttatcacggg
cggatagtactgccaccagagtatcccatgaaaccaccaagcattattctcctaacggct
aatggtcgatttgaagtgggcaagaaaatctgtttgagcatctcaggccatcatcctgaa
acttggcagccttcgtggagtataaggacagcattattagccatcattgggtttatgcca
acaaaaggagagggagccataggttctctagattacactcctgaggaaagaagagcactt
gccaaaaaatcacaagatttctgttgtgaaggatgtggctctgccatgaaggatgtcctg
ttgcctttaaaatctggaagcgattcaagccaagctgaccaagaagccaaagaactggct
aggcaaataagctttaaggcagaagtcaattcatctggaaagactatctctgagtcagac
ttaaaccactctttttcactaactgatttacaagatgatatacctacaacattccagggt
gctacggccagtacatcgtacggactccagaattcctcagcagcatcctttcatcaacct
acccaacctgtagctaagaatacctccatgagccctcgacagcgccgggcccagcagcag
agtcagagaaggttgtctacttcaccagatgtaatccagggccaccagccaagagacaac
cacactgatcatggtgggtcagctgtactgattgtcatcctgactttggcattggcagct
cttatattccgacgaatatatctggcaaacgaatacatatttgactttgagttataa

DBGET integrated database retrieval system