KEGG   Homo sapiens (human): 51503
Entry
51503             CDS       T01001                                 
Symbol
CWC15, AD002, C11orf5, Cwf15, HSPC148, ORF5
Name
(RefSeq) CWC15 spliceosome associated protein homolog
  KO
K12863  protein CWC15
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51503 (CWC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    51503 (CWC15)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    51503 (CWC15)
 Complex C
   Prp19-CDC5 complex
    51503 (CWC15)
SSDB
Motif
Pfam: Cwf_Cwc_15 UPF0524
Other DBs
NCBI-GeneID: 51503
NCBI-ProteinID: NP_057487
HGNC: 26939
Ensembl: ENSG00000150316
Pharos: Q9P013(Tdark)
UniProt: Q9P013
Structure
LinkDB
Position
11:complement(94962620..94973556)
AA seq 229 aa
MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFR
RELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEE
SDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQA
NFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgacaacagcagccaggccaacctttgaacctgccagaggtggaaggggaaaaggagaa
ggtgatttgagccaactttcaaagcagtattcaagcagagacctaccctctcatacaaag
ataaaatacagacagactactcaggatgcccctgaagaggttcgtaaccgtgacttcagg
agagagttggaagaaagagagagagctgctgcaagagagaaaaatagggatcgtccaacc
cgagaacatacaacctcctcttcagtgtcaaaaaagccacggttagaccagattcctgcc
gccaaccttgatgcagatgaccctctaacagatgaggaagatgaagattttgaagaagaa
agtgatgatgatgatactgcagctcttcttgcagaactggaaaaaattaaaaaagaaaga
gctgaagagcaggccaggaaggaacaagaacaaaaagctgaagaagagaggattcgtatg
gaaaacattctgagcggaaaccctctccttaatctcactggcccatcccagcctcaggcc
aacttcaaagttaaaagaaggtgggatgatgacgttgtcttcaagaactgtgcaaaaggt
gtagatgaccagaagaaagacaaaagatttgtaaatgacacactgcgatctgaatttcac
aaaaagttcatggagaaatatattaaatag

DBGET integrated database retrieval system