KEGG   Homo sapiens (human): 5160
Entry
5160              CDS       T01001                                 
Symbol
PDHA1, E1alpha, PDHA, PDHAD, PDHCE1A, PHE1A
Name
(RefSeq) pyruvate dehydrogenase E1 subunit alpha 1
  KO
K00161  pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa00785  Lipoic acid metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Network
nt06031  Citrate cycle and pyruvate metabolism
nt06032  Lipoic acid metabolism
  Element
N01603  Pyruvate oxidation
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H01997  Pyruvate dehydrogenase E1-alpha deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5160 (PDHA1)
   00020 Citrate cycle (TCA cycle)
    5160 (PDHA1)
   00620 Pyruvate metabolism
    5160 (PDHA1)
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    5160 (PDHA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5160 (PDHA1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5160 (PDHA1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5160 (PDHA1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5160 (PDHA1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5160 (PDHA1)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Other DBs
NCBI-GeneID: 5160
NCBI-ProteinID: NP_000275
OMIM: 300502
HGNC: 8806
Ensembl: ENSG00000131828
UniProt: P08559
Structure
LinkDB
Position
X:19343927..19361718
AA seq 390 aa
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYSSDPPFEVRGANQWIKFKSVS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaggaagatgctcgccgccgtctcccgcgtgctgtctggcgcttctcagaagccggca
agcagagtgctggtagcatcccgtaattttgcaaatgatgctacatttgaaattaagaaa
tgtgaccttcaccggctggaagaaggccctcctgtcacaacagtgctcaccagggaggat
gggctcaaatactacaggatgatgcagactgtacgccgaatggagttgaaagcagatcag
ctgtataaacagaaaattattcgtggtttctgtcacttgtgtgatggtcaggaagcttgc
tgtgtgggcctggaggccggcatcaaccccacagaccatctcatcacagcctaccgggct
cacggctttactttcacccggggcctttccgtccgagaaattctcgcagagcttacagga
cgaaaaggaggttgtgctaaagggaaaggaggatcgatgcacatgtatgccaagaacttc
tacgggggcaatggcatcgtgggagcgcaggtgcccctgggcgctgggattgctctagcc
tgtaagtataatggaaaagatgaggtctgcctgactttatatggcgatggtgctgctaac
cagggccagatattcgaagcttacaacatggcagctttgtggaaattaccttgtattttc
atctgtgagaataatcgctatggaatgggaacgtctgttgagagagcggcagccagcact
gattactacaagagaggcgatttcattcctgggctgagagtggatggaatggatatcctg
tgcgtccgagaggcaacaaggtttgctgctgcctattgtagatctgggaaggggcccatc
ctgatggagctgcagacttaccgttaccacggacacagtatgagtgaccctggagtcagt
taccgtacacgagaagaaattcaggaagtaagaagtaagagtgaccctattatgcttctc
aaggacaggatggtgaacagcaatcttgccagtgtggaagaactaaaggaaattgatgtg
gaagtgaggaaggagattgaggatgctgcccagtttgccacggccgatcctgagccacct
ttggaagagctgggctaccacatctactccagcgacccaccttttgaagttcgtggtgcc
aatcagtggatcaagtttaagtcagtcagttaa

KEGG   Homo sapiens (human): 5161
Entry
5161              CDS       T01001                                 
Symbol
PDHA2, PDHAL, SPGF70
Name
(RefSeq) pyruvate dehydrogenase E1 subunit alpha 2
  KO
K00161  pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa00785  Lipoic acid metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Network
nt06031  Citrate cycle and pyruvate metabolism
nt06032  Lipoic acid metabolism
  Element
N01603  Pyruvate oxidation
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5161 (PDHA2)
   00020 Citrate cycle (TCA cycle)
    5161 (PDHA2)
   00620 Pyruvate metabolism
    5161 (PDHA2)
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    5161 (PDHA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5161 (PDHA2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5161 (PDHA2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5161 (PDHA2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5161 (PDHA2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5161 (PDHA2)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 5161
NCBI-ProteinID: NP_005381
OMIM: 179061
HGNC: 8807
Ensembl: ENSG00000163114
UniProt: P29803
LinkDB
Position
4:95840093..95841464
AA seq 388 aa
MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGL
KYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
VCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACK
YKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDY
YKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYR
TREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLE
ELGHHIYSSDSSFEVRGANPWIKFKSVS
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctggccgccttcatctcccgcgtgttgaggcgagttgcccagaaatcagctcgcaga
gtgctggtggcatcccgtaactcctcaaatgacgctacatttgaaattaagaaatgtgat
ctttatctgttggaagagggtccccctgtcactacagtgctcactagggcggaggggctt
aaatactacaggatgatgctgactgttcgccgcatggaattgaaggcagatcagctgtac
aaacagaaattcattcgcggtttctgtcacctgtgcgatggtcaggaagcttgttgcgtg
ggccttgaggccggcataaacccctcggatcacgtcattacatcctatagggctcatggt
gtgtgctatactcggggactttctgtccgatccattctcgcagagctgacgggaagaaga
ggaggttgtgctaaaggaaaaggaggatcgatgcatatgtataccaagaacttctatggg
ggcaatggcatcgtcggtgcacagggccccctgggcgctggcattgctctggcctgtaaa
tataaaggaaacgatgagatctgtttgactttatatggggatggcgctgcgaatcagggg
cagatagccgaagctttcaatatggcagctttatggaaattaccttgtgttttcatctgt
gagaataacctatatggaatgggaacatctactgagagagcagcagccagccctgattac
tacaagaggggcaattttatccctgggctaaaggtcgatggaatggatgttctgtgtgtt
cgtgaggcaacaaaatttgcagctaactactgtagatctggaaaggggcccatactgatg
gagctgcaaacctaccgttatcatggacacagtatgagtgatcctggagtcagttatcgt
acacgagaagaaattcaggaagtaagaagtaagagggatcctataataattctccaagat
agaatggtaaacagcaagctcgccactgtggaagaattaaaggaaattggggctgaggtg
aggaaagaaattgatgatgctgcccagtttgctaccactgatcctgagccacatttggaa
gaattaggccatcacatctacagcagtgattcatcttttgaagttcgtggtgcaaatcca
tggatcaagtttaagtccgtcagttaa

KEGG   Homo sapiens (human): 5162
Entry
5162              CDS       T01001                                 
Symbol
PDHB, E1beta, PDHBD, PDHE1-B, PDHE1B, PHE1B
Name
(RefSeq) pyruvate dehydrogenase E1 subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa00785  Lipoic acid metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Network
nt06031  Citrate cycle and pyruvate metabolism
nt06032  Lipoic acid metabolism
  Element
N01603  Pyruvate oxidation
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H01998  Pyruvate dehydrogenase E1-beta deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5162 (PDHB)
   00020 Citrate cycle (TCA cycle)
    5162 (PDHB)
   00620 Pyruvate metabolism
    5162 (PDHB)
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    5162 (PDHB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5162 (PDHB)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5162 (PDHB)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5162 (PDHB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5162 (PDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5162 (PDHB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C Bacteriocin_IIc
Other DBs
NCBI-GeneID: 5162
NCBI-ProteinID: NP_000916
OMIM: 179060
HGNC: 8808
Ensembl: ENSG00000168291
UniProt: P11177 A0A384MDR8
Structure
LinkDB
Position
3:complement(58427630..58433832)
AA seq 359 aa
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggtgtctggcttggtgcggagaccccttcgggaggtctccgggctgctgaag
aggcgctttcactggaccgcgccggctgcgctgcaggtgacagttcgtgatgctataaat
cagggtatggatgaggagctggaaagagatgagaaggtatttctgcttggagaagaagtt
gcccagtatgatggggcatacaaggttagtcgagggctgtggaagaaatatggagacaag
aggattattgacactcccatatcagagatgggctttgctggaattgctgtaggtgcagct
atggctgggttgcggcccatttgtgaatttatgaccttcaatttctccatgcaagccatt
gaccaggttataaactcagctgccaagacctactacatgtctggtggccttcagcctgtg
cctatagtcttcagagggcccaatggtgcctcagcaggtgtagctgcccagcactcacag
tgctttgctgcctggtatgggcactgcccaggcttaaaggtggtcagtccctggaattca
gaggatgctaaaggacttattaaatcagccattcgggataacaatccagtggtggtgcta
gagaatgaattgatgtatggggttccttttgaatttcctccggaagctcagtcaaaagat
tttctgattcctattggaaaagccaaaatagaaaggcaaggaacacatataactgtggtt
tcccattcaagacctgtgggccactgcttagaagctgcagcagtgctatctaaagaagga
gttgaatgtgaggtgataaatatgcgtaccattagaccaatggacatggaaaccatagaa
gccagtgtcatgaagacaaatcatcttgtaactgtggaaggaggctggccacagtttgga
gtaggagctgaaatctgtgccaggatcatggaaggtcctgcgttcaatttcctggatgct
cctgctgttcgtgtcactggtgctgatgtccctatgccttatgcaaagattctagaggac
aactctatacctcaggtcaaagacatcatatttgcaataaagaaaacattaaatatttag

DBGET integrated database retrieval system