KEGG   Homo sapiens (human): 51738
Entry
51738             CDS       T01001                                 
Symbol
GHRL, MTLRP
Name
(RefSeq) ghrelin and obestatin prepropeptide
  KO
K05254  ghrelin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
Disease
H01703  Eating Disorders
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    51738 (GHRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    51738 (GHRL)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    51738 (GHRL)
SSDB
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Other DBs
NCBI-GeneID: 51738
NCBI-ProteinID: NP_001289750
OMIM: 605353
HGNC: 18129
Ensembl: ENSG00000157017
Pharos: Q9UBU3(Tchem)
CPD: C16025 C16102
UniProt: Q9UBU3
Structure
LinkDB
Position
3:complement(10285666..10292947)
AA seq 117 aa
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgccctccccagggaccgtctgcagcctcctgctcctcggcatgctctggctggacttg
gccatggcaggctccagcttcctgagccctgaacaccagagagtccagcagagaaaggag
tcgaagaagccaccagccaagctgcagccccgagctctagcaggctggctccgcccggaa
gatggaggtcaagcagaaggggcagaggatgaactggaagtccggttcaacgcccccttt
gatgttggaatcaagctgtcaggggttcagtaccagcagcacagccaggccctggggaag
tttcttcaggacatcctctgggaagaggccaaagaggccccagccgacaagtga

DBGET integrated database retrieval system