KEGG   Homo sapiens (human): 51805
Entry
51805             CDS       T01001                                 
Symbol
COQ3, DHHBMT, DHHBMTASE, UG0215E05, bA9819.1
Name
(RefSeq) coenzyme Q3, methyltransferase
  KO
K00591  polyprenyldihydroxybenzoate methyltransferase / 3-demethylubiquinol 3-O-methyltransferase [EC:2.1.1.114 2.1.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00128  Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate + polyprenyl-PP => ubiquinol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    51805 (COQ3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     51805 (COQ3)
    2.1.1.114  polyprenyldihydroxybenzoate methyltransferase
     51805 (COQ3)
SSDB
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_31 CMAS Ubie_methyltran PrmA MTS Methyltransf_9 Methyltransf_PK NodS Pox_MCEL Methyltransf_15 ADH_zinc_N Methyltransf_32
Other DBs
NCBI-GeneID: 51805
NCBI-ProteinID: NP_059117
OMIM: 605196
HGNC: 18175
Ensembl: ENSG00000132423
Pharos: Q9NZJ6(Tbio)
UniProt: Q9NZJ6
LinkDB
Position
6:complement(99369401..99394195)
AA seq 369 aa
MWSGRKLGSSGGWFLRVLGPGGCNTKAARPLISSAVYVKNQLSGTLQIKPGVFNEYRTIW
FKSYRTIFSCLNRIKSFRYPWARLYSTSQTTVDSGEVKTFLALAHKWWDEQGVYAPLHSM
NDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPVDEN
IKTAQCHKSFDPVLDKRIEYRVCSLEEIVEETAETFDAVVASEVVEHVIDLETFLQCCCQ
VLKPGGSLFITTINKTQLSYALGIVFSEQIASIVPKGTHTWEKFVSPETLESILESNGLS
VQTVVGMLYNPFSGYWHWSENTSLNYAAYAVKSRVQEHPASAEFVLKGETEELQANACTN
PAVHEKLKK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgtggagtggccgtaagctgggctcctccgggggttggtttttaagagtgctggggcct
ggaggctgtaatacaaaagctgcgcgtcccttaatttcctcggcggtttatgtgaagaac
cagctcagtgggactctacagattaaaccaggggttttcaatgaatacagaaccatatgg
ttcaaatcctacaggacgatcttttcctgtttgaacagaataaagagtttcaggtaccct
tgggcgagactgtacagtacttcccaaaccactgtcgacagcggtgaggtaaaaaccttc
ttggccctggctcacaaatggtgggatgaacaaggagtatatgcacctcttcattccatg
aatgacctgagggtgccatttattagggacaatcttctgaaaacaattcctaatcaccag
ccaggaaaacctttgttggggatgaagattcttgacgttggctgtggtggtgggctgtta
actgaacctctagggcggcttggggcttcagttattggaatcgaccctgtggatgagaac
attaaaacagcacaatgccataaatcatttgatccagtcctggataagagaatagagtac
agagtgtgttccctggaagagattgtggaagagactgcagaaacatttgatgctgttgta
gcttctgaagttgtagaacatgtgattgatctagaaacatttttacagtgctgctgtcaa
gtgttaaaacccggtggttctttattcattactacaatcaacaaaacacaactttcctat
gccttgggaattgttttttcagagcaaattgcaagtattgtaccaaaaggtactcataca
tgggagaagtttgtttcacctgaaacactagagagcattctggaatcaaatggtctgtca
gttcaaacagtggtaggaatgctctataaccccttctcaggttactggcattggagtgaa
aataccagccttaactatgcagcttatgctgtgaaatccagggtccaggaacacccagcc
tctgctgagtttgttttaaagggagaaacagaagagctccaagctaatgcctgcaccaat
ccagctgtgcatgaaaagctgaagaaatga

DBGET integrated database retrieval system