KEGG   Homo sapiens (human): 5208
Entry
5208              CDS       T01001                                 
Symbol
PFKFB2, PFK-2/FBPase-2
Name
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
  KO
K19029  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 2 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa04152  AMPK signaling pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5208 (PFKFB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5208 (PFKFB2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5208 (PFKFB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5208 (PFKFB2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5208 (PFKFB2)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 KTI12 His_Phos_2 Zeta_toxin
Other DBs
NCBI-GeneID: 5208
NCBI-ProteinID: NP_006203
OMIM: 171835
HGNC: 8873
Ensembl: ENSG00000123836
Pharos: O60825(Tchem)
UniProt: O60825
Structure
LinkDB
Position
1:207034416..207081027
AA seq 505 aa
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTR
YLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEE
NGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPE
RNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVY
YLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVW
TSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRY
PGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPR
NYSVGSRPLKPLSPLRAQDMQEGAD
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtctggggcatcttcctcagaacagaacaacaacagctatgaaaccaaaaccccaaat
cttcgaatgtcagagaagaaatgttcatgggcctcctacatgaccaactccccgactctg
atcgttatgattggtttgccagcccggggtaaaacctacgtgtccaagaaactaacacgc
tacctcaactggattggagtccccaccaaagtgtttaatcttggggtgtatcggcgtgaa
gcagtcaagtcctataagtcctacgacttctttcggcatgacaatgaggaggccatgaag
atccgcaaacagtgtgctctggtggcgctggaagatgttaaggcgtatctcactgaggag
aatggtcagattgcggtgtttgatgccaccaatacaacccgggagaggagggacatgatt
ttgaactttgctgaacagaattccttcaaggtattctttgtggaatccgtctgtgatgat
cctgatgtcattgctgccaatattctggaggttaaggtatcaagccctgactatcctgaa
aggaacagagagaacgtgatggaggacttcctgaagagaattgaatgctacaaagttacc
taccgacctcttgacccagacaactatgacaaggatctttctttcatcaaggtgataaac
gtgggccagcgatttttagtcaacagagtccaggactacatccagagcaagatagtctac
tacctcatgaatatccacgtccagcctcgcaccatttacctttgccggcatggagaaagc
gagttcaatctcttggggaagattgggggtgactctggcctctcggtgcggggaaagcag
tttgcccaagctctaaggaaatttctggaggaacaggaaataacagacctcaaagtgtgg
acaagccagttgaagaggaccatacagactgctgaatctctcggggtgccctatgagcag
tggaagattctgaatgagattgatgctggtgtgtgtgaagagatgacctatgcagagatt
gagaaacggtacccagaagagtttgcacttcgagatcaagagaagtatctgtatcgatat
cctggtggggagtcataccaggacctggtgcagcggctggagcctgtcatcatggagctg
gaacgtcagggcaatgtcctcgtcatctcccaccaggctgtcatgcgctgcctcctggcc
tacttcttggataagggcgcagatgagctaccatacttgagatgccctctccataccatc
ttcaaacttactcctgtggcctatgggtgcaaagtggaaacaattaaacttaacgtggag
gctgtgaacacgcaccgtgacaagccaactaacaacttccccaagaaccaaacccctgta
aggatgagaaggaacagctttacgcctctgtccagttcgaatacaataaggcgtccaaga
aattacagtgttgggagccggcccctcaagcccctcagccctctccgtgcccaggacatg
caagaaggggccgactag

DBGET integrated database retrieval system