KEGG   Homo sapiens (human): 5305
Entry
5305              CDS       T01001                                 
Symbol
PIP4K2A, PI5P4KA, PIP5K2A, PIP5KII-alpha, PIP5KIIA, PIPK
Name
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 alpha
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5305 (PIP4K2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5305 (PIP4K2A)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5305 (PIP4K2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     5305 (PIP4K2A)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 5305
NCBI-ProteinID: NP_005019
OMIM: 603140
HGNC: 8997
Ensembl: ENSG00000150867
Vega: OTTHUMG00000017810
Pharos: P48426(Tbio)
UniProt: P48426
Structure
LinkDB
Position
10:complement(22534854..22714578)
AA seq 406 aa
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVM
LMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSA
PLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLG
MYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEE
EGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDI
LTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgacccccggcaacctagggtcctctgtcctggcgagcaagaccaagaccaagaag
aagcacttcgtagcgcagaaagtgaagctgtttcgggccagcgacccgctgctcagcgtc
ctcatgtggggggtaaaccactcgatcaatgaactgagccatgttcaaatccctgttatg
ttgatgccagatgacttcaaagcctattcaaaaataaaggtggacaatcacctttttaac
aaagaaaacatgccgagccatttcaagtttaaggaatactgcccgatggtcttccgtaac
ctgcgggagaggtttggaattgatgatcaagatttccagaattccctgaccaggagcgca
cccctccccaacgactcccaggcccgcagtggagctcgttttcacacttcctacgacaaa
agatacatcatcaagactattaccagtgaagacgtggccgaaatgcacaacatcctgaag
aaataccaccagtacatagtggaatgtcatgggatcacccttcttccccagttcttgggc
atgtaccggcttaatgttgatggagttgaaatatatgtgatagttacaagaaatgtattc
agccaccgtttgtctgtgtataggaaatacgacttaaagggctctacagtggctagagaa
gctagtgacaaagaaaaggccaaagaactgccaactctgaaagataatgatttcattaat
gagggccaaaagatttatattgatgacaacaacaagaaggtcttcctggaaaaactaaaa
aaggatgttgagtttctggcccagctgaagctcatggactacagtctgctggtgggaatt
catgatgtggagagagccgaacaggaggaagtggagtgtgaggagaacgatggggaggag
gagggcgagagcgatggcacccacccggtgggaacccccccagatagccccgggaataca
ctgaacagctcaccacccctggctcccggggagttcgatccgaacatcgacgtctatgga
attaagtgccatgaaaactcgcctaggaaggaggtgtacttcatggcaattattgacatc
cttactcattatgatgcaaaaaagaaagctgcccatgctgcaaaaactgttaaacatggc
gctggcgcggagatctccaccgtgaacccagaacagtattcaaagcgctttttggacttt
attggccacatcttgacgtaa

KEGG   Homo sapiens (human): 79837
Entry
79837             CDS       T01001                                 
Symbol
PIP4K2C, PIP5K2C
Name
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 gamma
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    79837 (PIP4K2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    79837 (PIP4K2C)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79837 (PIP4K2C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     79837 (PIP4K2C)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 79837
NCBI-ProteinID: NP_001139730
OMIM: 617104
HGNC: 23786
Ensembl: ENSG00000166908
Vega: OTTHUMG00000170144
Pharos: Q8TBX8(Tbio)
UniProt: Q8TBX8 B3KQV3
Structure
LinkDB
Position
12:57591192..57603418
AA seq 421 aa
MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEA
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcgtcctcctcggtcccaccagccacggtatcggcggcgacagcaggccccggccca
ggtttcggcttcgcctccaagaccaagaagaagcatttcgtgcagcagaaggtgaaggtg
ttccgggcggccgacccgctggtgggtgtgttcctgtggggcgtagcccactcgatcaat
gagctcagccaggtgcctcccccggtgatgctgctgccagatgactttaaggccagctcc
aagatcaaggtcaacaatcaccttttccacagggaaaatctgcccagtcatttcaagttc
aaggagtattgtccccaggtcttcaggaacctccgtgatcgatttggcattgatgaccaa
gattacttggtgtcccttacccgaaacccccccagcgaaagtgaaggcagtgatggtcgc
ttccttatctcctacgatcggactctggtcatcaaagaagtatccagtgaggacattgct
gacatgcatagcaacctctccaactatcaccagtacattgtgaagtgccatggcaacacg
cttctgccccagttcctggggatgtaccgagtcagtgtggacaacgaagacagctacatg
cttgtgatgcgcaatatgtttagccaccgtcttcctgtgcacaggaagtatgacctcaag
ggttccctagtgtcccgggaagccagcgataaggaaaaggttaaagaattgcccaccctt
aaggatatggactttctcaacaagaaccagaaagtatatattggtgaagaggagaagaaa
atatttctggagaagctgaagagagatgtggagtttctagtgcagctgaagatcatggac
tacagccttctgctaggcatccacgacatcattcggggctctgaaccagaggaggaagcg
cccgtgcgggaggatgagtcagaggtggatggggactgcagcctgactggacctcctgct
ctggtgggctcctatggcacctccccagagggtatcggaggctacatccattcccatcgg
cccctgggcccaggagagtttgagtccttcattgatgtctatgccatccggagtgctgaa
ggagccccccagaaggaggtctacttcatgggcctcattgatatccttacacagtatgat
gctaagaagaaagcagctcatgcagccaaaactgtcaagcatggggctggggcagagatc
tctactgtccatccggagcagtatgctaagcgattcctggattttattaccaacatcttt
gcctaa

KEGG   Homo sapiens (human): 8396
Entry
8396              CDS       T01001                                 
Symbol
PIP4K2B, PI5P4KB, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PIP5P4KB
Name
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 beta
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8396 (PIP4K2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8396 (PIP4K2B)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8396 (PIP4K2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     8396 (PIP4K2B)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 8396
NCBI-ProteinID: NP_003550
OMIM: 603261
HGNC: 8998
Ensembl: ENSG00000276293
Vega: OTTHUMG00000188504
Pharos: P78356(Tchem)
UniProt: P78356
Structure
LinkDB
Position
17:complement(38765691..38799556)
AA seq 416 aa
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK
EVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtcgtccaactgcaccagcaccacggcggtggcggtggcgccgctcagcgccagcaag
accaagaccaagaagaagcatttcgtgtgccagaaagtgaagctattccgggccagcgag
ccgatcctcagcgtcctgatgtggggggtgaaccacacgatcaatgagctgagcaatgtt
cctgttcctgtcatgctaatgccagatgacttcaaagcctacagcaagatcaaggtggac
aatcatctcttcaataaggagaacctgcccagccgctttaagtttaaggagtattgcccc
atggtgttccgaaaccttcgggagaggtttggaattgatgatcaggattaccagaattca
gtgacgcgcagcgcccccatcaacagtgacagccagggtcggtgtggcacgcgtttcctc
accacctacgaccggcgctttgtcatcaagactgtgtccagcgaggacgtggcggagatg
cacaacatcttaaagaaataccaccagtttatagtggagtgtcatggcaacacgcttttg
ccacagttcctgggcatgtaccgcctgaccgtggatggtgtggaaacctacatggtggtt
accaggaacgtgttcagccatcggctcactgtgcatcgcaagtatgacctcaagggttct
acggttgccagagaagcgagcgacaaggagaaggccaaggacttgccaacattcaaagac
aatgacttcctcaatgaagggcagaagctgcatgtgggagaggagagtaaaaagaacttc
ctggagaaactgaagcgggacgttgagttcttggcacagctgaagatcatggactacagc
ctgctggtgggcatccacgacgtggaccgggcagagcaggaggagatggaggtggaggag
cgggcagaggacgaggagtgtgagaatgatggggtgggtggcaacctactctgctcctat
ggcacacctccggacagccctggcaacctcctcagctttcctcggttctttggtcctggg
gaattcgacccctctgttgacgtctatgccatgaaaagccatgaaagttcccccaagaag
gaggtgtatttcatggccatcattgatatcctcacgccatacgatacaaagaagaaagct
gcacatgctgccaaaacggtgaaacacggggcaggggccgagatctcgactgtgaaccct
gagcagtactccaaacgcttcaacgagtttatgtccaacatcctgacgtag

DBGET integrated database retrieval system