KEGG   Homo sapiens (human): 5345
Entry
5345              CDS       T01001                                 
Symbol
SERPINF2, A2AP, AAP, ALPHA-2-PI, API, PLI, alpha2AP
Name
(RefSeq) serpin family F member 2
  KO
K03983  alpha-2-antiplasmin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06514  Coagulation cascade
  Element
N01522  Regulation of fibrinolytic system, AAP
Disease
H00983  Alpha-2-plasmin inhibitor (a2-PI) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5345 (SERPINF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5345 (SERPINF2)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5345 (SERPINF2)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 5345
NCBI-ProteinID: NP_000925
OMIM: 613168
HGNC: 9075
Ensembl: ENSG00000167711
Pharos: P08697(Tbio)
UniProt: P08697
LinkDB
Position
17:1742871..1755265
AA seq 491 aa
MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQ
TALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHL
ALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLE
QSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGF
WRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELF
QAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPM
EEDYPQFGSPK
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggcgctgctctgggggctcctggtgctcagctggtcctgcctgcaaggcccctgctcc
gtgttctcccctgtgagcgccatggagcccttgggccggcagctaactagcgggccgaac
caggagcaggtgtccccacttaccctcctcaagttgggcaaccaggagcctggtggccag
actgccctgaagagtcccccaggagtctgcagcagagaccccaccccagagcagacccac
aggctggcccgggccatgatggccttcactgccgacctgttctccctggtggctcaaacg
tccacctgccccaacctcatcctgtcacccctgagtgtggccctggcgctgtctcacctg
gcactaggtgctcagaaccacacgttgcagaggctgcaacaggtgctgcacgcaggctca
gggccctgcctcccccatctgctgagccgcctctgccaggacctgggccccggcgcgttc
cgactggctgccaggatgtacctgcagaaaggatttcccatcaaagaagatttcctggaa
caatccgaacagctatttggggcaaagcccgtgagcctgacgggaaagcaggaagatgac
ctggcaaacatcaaccaatgggtgaaggaggccacggaggggaagattcaggaattcctc
tctgggctgccggaagacaccgtgttgcttctcctcaacgccatccacttccagggtttc
tggaggaacaagtttgacccgagccttacccagagagactccttccacctggacgagcag
ttcacggtgcccgtggaaatgatgcaggcccgcacgtacccgctgcgctggttcttgctg
gagcagcctgagatccaggtggctcatttcccctttaagaacaacatgagctttgtggtc
cttgtacccacccactttgaatggaacgtgtcccaggtactggccaacctgagttgggac
accctgcacccacctctggtgtgggagaggcccaccaaggtccggctgcctaagctgtat
ctgaaacaccaaatggacctggtggccaccctcagccagctgggcctgcaggagttgttc
caggccccagacctgcgtgggatctccgagcagagcctggtggtgtccggcgtgcagcat
cagtccaccctggagctcagcgaggtcggcgtggaggcggcggcggccaccagcattgcc
atgtcccgcatgtccctgtcctccttcagcgtgaaccgccccttcctcttcttcatcttc
gaggacaccacaggccttcccctcttcgtgggcagcgtgaggaaccccaaccccagtgca
ccgcgggagctcaaggaacagcaggattccccgggcaacaaggacttcctccagagcctg
aaaggcttcccccgcggagacaagcttttcggccctgacttaaaacttgtgccccccatg
gaggaggattacccccagtttggcagccccaagtga

DBGET integrated database retrieval system