KEGG   Homo sapiens (human): 53833
Entry
53833             CDS       T01001                                 
Symbol
IL20RB, DIRS1, FNDC6, IL-20R2
Name
(RefSeq) interleukin 20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01271  IL19/20/24 to IL20R signaling
N01272  YLDV 134R to IL20R signaling
N01273  IL20/24 to IL20R/22R signaling
N01274  YLDV 134R to IL20R/22R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    53833 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    53833 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    53833 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    53833 (IL20RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL10/28 receptor family
   53833 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 53833
NCBI-ProteinID: NP_653318
OMIM: 605621
HGNC: 6004
Ensembl: ENSG00000174564
Pharos: Q6UXL0(Tbio)
UniProt: Q6UXL0
Structure
LinkDB
Position
3:136957983..137011085
AA seq 311 aa
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAP
GETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQ
TSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHV
KMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcagactttcacaatggttctagaagaaatctggacaagtcttttcatgtggtttttc
tacgcattgattccatgtttgctcacagatgaagtggccattctgcctgcccctcagaac
ctctctgtactctcaaccaacatgaagcatctcttgatgtggagcccagtgatcgcgcct
ggagaaacagtgtactattctgtcgaataccagggggagtacgagagcctgtacacgagc
cacatctggatccccagcagctggtgctcactcactgaaggtcctgagtgtgatgtcact
gatgacatcacggccactgtgccatacaaccttcgtgtcagggccacattgggctcacag
acctcagcctggagcatcctgaagcatccctttaatagaaactcaaccatccttacccga
cctgggatggagatcaccaaagatggcttccacctggttattgagctggaggacctgggg
ccccagtttgagttccttgtggcctactggaggagggagcctggtgccgaggaacatgtc
aaaatggtgaggagtgggggtattccagtgcacctagaaaccatggagccaggggctgca
tactgtgtgaaggcccagacattcgtgaaggccattgggaggtacagcgccttcagccag
acagaatgtgtggaggtgcaaggagaggccattcccctggtactggccctgtttgccttt
gttggcttcatgctgatccttgtggtcgtgccactgttcgtctggaaaatgggccggctg
ctccagtactcctgttgccccgtggtggtcctcccagacaccttgaaaataaccaattca
ccccagaagttaatcagctgcagaagggaggaggtggatgcctgtgccacggctgtgatg
tctcctgaggaactcctcagggcctggatctcatag

DBGET integrated database retrieval system