KEGG   Homo sapiens (human): 5460Help
Entry
5460              CDS       T01001                                 

Gene name
POU5F1, OCT3, OCT4, OTF-3, OTF3, OTF4, Oct-3, Oct-4
Definition
(RefSeq) POU class 5 homeobox 1
  KO
K09367  POU domain transcription factor, class 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5460 (POU5F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5460 (POU5F1)
   03021 Transcription machinery [BR:hsa03021]
    5460 (POU5F1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   POU domain factors
    5460 (POU5F1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     5460 (POU5F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain DUF521 HOCHOB
Motif
Other DBs
NCBI-GeneID: 5460
NCBI-ProteinID: NP_002692
OMIM: 164177
HGNC: 9221
Ensembl: ENSG00000204531
Vega: OTTHUMG00000031206
Pharos: Q01860(Tbio)
UniProt: Q01860 D2IYK3
LinkDB All DBs
Position
6p21.33
AA seq 360 aa AA seqDB search
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG
AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS
QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR
VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA
AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacacctggcttcggatttcgccttctcgccccctccaggtggtggaggtgat
gggccaggggggccggagccgggctgggttgatcctcggacctggctaagcttccaaggc
cctcctggagggccaggaatcgggccgggggttgggccaggctctgaggtgtgggggatt
cccccatgccccccgccgtatgagttctgtggggggatggcgtactgtgggccccaggtt
ggagtggggctagtgccccaaggcggcttggagacctctcagcctgagggcgaagcagga
gtcggggtggagagcaactccgatggggcctccccggagccctgcaccgtcacccctggt
gccgtgaagctggagaaggagaagctggagcaaaacccggaggagtcccaggacatcaaa
gctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctg
ggatatacacaggccgatgtggggctcaccctgggggttctatttgggaaggtattcagc
caaacgaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctg
cggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagata
tgcaaagcagaaaccctcgtgcaggcccgaaagagaaagcgaaccagtatcgagaaccga
gtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagcagatc
agccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaac
cggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggct
gctgggtctcctttctcagggggaccagtgtcctttcctctggccccagggccccatttt
ggtaccccaggctatgggagccctcacttcactgcactgtactcctcggtccctttccct
gagggggaagcctttccccctgtctccgtcaccactctgggctctcccatgcattcaaac
tga

DBGET integrated database retrieval system