KEGG   Homo sapiens (human): 5471
Entry
5471              CDS       T01001                                 
Symbol
PPAT, ATASE, GPAT, PRAT
Name
(RefSeq) phosphoribosyl pyrophosphate amidotransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5471 (PPAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    5471 (PPAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5471 (PPAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     5471 (PPAT)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C44
   5471 (PPAT)
SSDB
Motif
Pfam: GATase_6 GATase_7 GATase_4 Pribosyltran PRTase_2 UPRTase
Other DBs
NCBI-GeneID: 5471
NCBI-ProteinID: NP_002694
OMIM: 172450
HGNC: 9238
Ensembl: ENSG00000128059
Vega: OTTHUMG00000128842
Pharos: Q06203(Tclin)
UniProt: Q06203 A8K4H7 Q59G63
LinkDB
Position
4:complement(56393362..56435615)
AA seq 517 aa
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE
KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggagctggaggagttggggatccgagaggaatgtggcgtgttcgggtgcatcgcctca
ggagagtggcccacgcagctggatgtaccgcatgtgatcactctgggactcgtggggctg
cagcaccggggtcaggagagtgctggtattgtgactagtgatgggagttcggtgccaaca
ttcaaatcacacaagggaatgggtcttgtaaatcacgtctttactgaagacaatttgaaa
aaattatatgtttcaaatcttggaattggacacaccaggtatgccaccacaggaaaatgt
gaactagaaaattgtcagcccttcgttgttgaaacacttcatgggaagatagctgtggca
cataatggcgaattggtaaatgctgctcgattaaggaaaaagcttctgcgtcatggtatt
ggtctgtctacaagttctgatagtgaaatgattacccagttactggcgtatacccctcct
caggaacaagatgacaccccagactgggtagccaggattaaaaacttgatgaaggaagca
cccacagcatactccctgcttataatgcacagagatgttatttatgcagtacgagatcct
tatggaaatcgtcccttatgcattggtcgtcttattccagtgtctgatataaatgacaaa
gagaaaaaaacatcagaaacagaaggatgggtggtgtcttcagaatcttgtagcttctta
tctattggtgcaagatattaccgtgaagtcttgcctggagaaattgtggaaatatccaga
cacaatgtccaaactcttgatattatatcaaggtctgaaggaaacccagtggctttttgt
atctttgaatatgtttattttgcaagaccagacagtatgttcgaagaccaaatggtttat
acagtaagataccgttgtggccagcagctagcgattgaagcacctgtggatgcagatttg
gttagcactgttccagaatctgctacgcctgctgctcttgcttacgcaggaaagtgtgga
cttccatatgtggaggtgctgtgtaaaaaccggtatgtagggagaaccttcattcagcca
aacatgaggttaagacaacttggtgttgcaaaaaaatttggagtattgtcagacaacttt
aaaggcaaaagaattgttcttgtagatgattcaattgtcagaggcaataccatctcacct
ataataaaactgctcaaagaatctggtgcaaaagaggtacacattcgagtagcttcacca
ccaattaaatatccatgcttcatgggaataaacattcctacaaaagaagagctcattgcc
aataaaccagaatttgatcaccttgcagaatatctaggagcaaacagtgttgtgtatctg
tcagtagaaggactggtttcatctgtacaagaagggataaagtttaaaaaacagaaagag
aaaaagcacgatattatgatccaagaaaatggaaatggtctggaatgttttgaaaagagt
ggtcattgtacagcttgtctcactggaaaatatcctgtagaattagaatggtag

DBGET integrated database retrieval system