Homo sapiens (human): 5478 Help Entry 5478              CDS       T01001                                  Symbol PPIA, CYPA, CYPH, HEL-S-69p Name (RefSeq) peptidylprolyl isomerase A   KO K03767   peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8] Organism hsa  Homo sapiens (human) Pathway hsa03250   Viral life cycle - HIV-1 hsa04217   Necroptosis Drug target Alisporivir:  D10087 Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     5478 (PPIA)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     5478 (PPIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hsa03110]     5478 (PPIA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     5478 (PPIA) Enzymes [BR:hsa01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      5478 (PPIA) Chaperones and folding catalysts [BR:hsa03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Cyclophilin     5478 (PPIA) Exosome [BR:hsa04147]  Exosomal proteins   Proteins found in most exosomes    5478 (PPIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pro_isomerase Motif Other DBs NCBI-GeneID:  5478 NCBI-ProteinID:  NP_066953 OMIM:  123840 HGNC:  9253 Ensembl:  ENSG00000196262 UniProt:  P62937 V9HWF5 Structure PDBPDBj LinkDB All DBs Position 7:44796681..44803117 Genome browser AA seq 165 aa AA seqDB search MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggtcaaccccaccgtgttcttcgacattgccgtcgacggcgagcccttgggccgcgtc tcctttgagctgtttgcagacaaggtcccaaagacagcagaaaattttcgtgctctgagc actggagagaaaggatttggttataagggttcctgctttcacagaattattccagggttt atgtgtcagggtggtgacttcacacgccataatggcactggtggcaagtccatctatggg gagaaatttgaagatgagaacttcatcctaaagcatacgggtcctggcatcttgtccatg gcaaatgctggacccaacacaaatggttcccagtttttcatctgcactgccaagactgag tggttggatggcaagcatgtggtgtttggcaaagtgaaagaaggcatgaatattgtggag gccatggagcgctttgggtccaggaatggcaagaccagcaagaagatcaccattgctgac tgtggacaactcgaataa

DBGET integrated database retrieval system