KEGG   Homo sapiens (human): 5478
Entry
5478              CDS       T01001                                 
Symbol
PPIA, CYPA, CYPH, HEL-S-69p
Name
(RefSeq) peptidylprolyl isomerase A
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04217  Necroptosis
Drug target
Alisporivir: D10087
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    5478 (PPIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5478 (PPIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5478 (PPIA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5478 (PPIA)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5478 (PPIA)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    5478 (PPIA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5478 (PPIA)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 5478
NCBI-ProteinID: NP_066953
OMIM: 123840
HGNC: 9253
Ensembl: ENSG00000196262
Vega: OTTHUMG00000023687
Pharos: P62937(Tclin)
UniProt: P62937 V9HWF5
Structure
LinkDB
Position
7:44796681..44803117
AA seq 165 aa
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
NT seq 498 nt   +upstreamnt  +downstreamnt
atggtcaaccccaccgtgttcttcgacattgccgtcgacggcgagcccttgggccgcgtc
tcctttgagctgtttgcagacaaggtcccaaagacagcagaaaattttcgtgctctgagc
actggagagaaaggatttggttataagggttcctgctttcacagaattattccagggttt
atgtgtcagggtggtgacttcacacgccataatggcactggtggcaagtccatctatggg
gagaaatttgaagatgagaacttcatcctaaagcatacgggtcctggcatcttgtccatg
gcaaatgctggacccaacacaaatggttcccagtttttcatctgcactgccaagactgag
tggttggatggcaagcatgtggtgtttggcaaagtgaaagaaggcatgaatattgtggag
gccatggagcgctttgggtccaggaatggcaagaccagcaagaagatcaccattgctgac
tgtggacaactcgaataa

DBGET integrated database retrieval system