KEGG   Homo sapiens (human): 54926
Entry
54926             CDS       T01001                                 
Symbol
UBE2R2, CDC34B, E2-CDC34B, UBC3B
Name
(RefSeq) ubiquitin conjugating enzyme E2 R2
  KO
K02207  ubiquitin-conjugating enzyme E2 R [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    54926 (UBE2R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    54926 (UBE2R2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     54926 (UBE2R2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   54926 (UBE2R2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 54926
NCBI-ProteinID: NP_060281
OMIM: 612506
HGNC: 19907
Ensembl: ENSG00000107341
Pharos: Q712K3(Tbio)
UniProt: Q712K3
Structure
LinkDB
Position
9:33815168..33920399
AA seq 238 aa
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKA
HIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDG
VKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcccagcagcagatgaccagctcgcagaaggccctgatgctcgagctgaaatccctg
caggaggaaccggtggagggcttccggatcaccctggtggacgagtccgacctctacaac
tgggaggtggccatcttcggaccccccaacaccctctacgaaggcggctacttcaaggcg
catattaaatttcctattgactacccctattcaccacctaccttcagattcttgaccaaa
atgtggcaccccaacatttatgagaatggagatgtatgcatttcgattcttcatccgcct
gtagatgacccacagagtggagaactgccttctgaaaggtggaatcctactcagaatgtg
aggactatcctattaagtgtaatctcactgcttaatgagcccaacaccttctccccagcc
aatgtcgatgcttcagttatgttcaggaaatggagagacagtaaaggaaaagacaaagaa
tatgctgaaattattaggaaacaagtttcagccactaaggccgaagcagaaaaggatgga
gtgaaggtccccacaaccctggcggaatactgcatcaaaactaaagtgccttccaatgac
aacagctcagatttgctttacgacgacttgtatgatgacgacattgatgatgaagatgag
gaggaggaagatgccgactgttatgatgatgatgattctgggaatgaggagtcgtga

KEGG   Homo sapiens (human): 997
Entry
997               CDS       T01001                                 
Symbol
CDC34, E2-CDC34, UBC3, UBCH3, UBE2R1
Name
(RefSeq) cell division cycle 34, ubiqiutin conjugating enzyme
  KO
K02207  ubiquitin-conjugating enzyme E2 R [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    997 (CDC34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    997 (CDC34)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     997 (CDC34)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   997 (CDC34)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 997
NCBI-ProteinID: NP_004350
OMIM: 116948
HGNC: 1734
Ensembl: ENSG00000099804
Pharos: P49427(Tbio)
UniProt: P49427 A0A024R1Z1
Structure
LinkDB
Position
19:531760..542087
AA seq 236 aa
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
NT seq 711 nt   +upstreamnt  +downstreamnt
atggctcggccgctagtgcccagctcgcagaaggcgctgctgctggagctcaaggggctg
caggaagagccggtcgagggattccgcgtgacactggtggacgagggcgatctatacaac
tgggaggtggccatcttcgggccccccaacacctactacgagggcggctacttcaaggcg
cgcctcaagttccccatcgactacccatactctccaccagcctttcggttcctgaccaag
atgtggcaccctaacatctacgagacgggggacgtgtgtatctccatcctccacccgccg
gtggacgacccccagagcggggagctgccctcagagaggtggaaccccacgcagaacgtc
aggaccattctcctgagtgtgatctccctcctgaacgagcccaacaccttctcgcccgca
aacgtggacgcctccgtgatgtacaggaagtggaaagagagcaaggggaaggatcgggag
tacacagacatcatccggaagcaggtcctggggaccaaggtggacgcggagcgtgacggc
gtgaaggtgcccaccacgctggccgagtactgcgtgaagaccaaggcgccggcgcccgac
gagggctcagacctcttctacgacgactactacgaggacggcgaggtggaggaggaggcc
gacagctgcttcggggacgatgaggatgactctggcacggaggagtcctga

DBGET integrated database retrieval system