KEGG   Homo sapiens (human): 54949
Entry
54949             CDS       T01001                                 
Symbol
SDHAF2, C11orf79, PGL2, SDH5, hSDH5
Name
(RefSeq) succinate dehydrogenase complex assembly factor 2
  KO
K18168  succinate dehydrogenase assembly factor 2
Organism
hsa  Homo sapiens (human)
Disease
H02538  Paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    54949 (SDHAF2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-II assembly factors
    54949 (SDHAF2)
SSDB
Motif
Pfam: Sdh5 TFIIE_alpha DUF1689 Reovirus_cap
Other DBs
NCBI-GeneID: 54949
NCBI-ProteinID: NP_060311
OMIM: 613019
HGNC: 26034
Ensembl: ENSG00000167985
Pharos: Q9NX18(Tbio)
UniProt: Q9NX18
Structure
LinkDB
Position
11:61430124..61446733
AA seq 166 aa
MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTD
ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY
WATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFEKPR
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcggtgtctacagtgttctcgacttcgtcgctgatgcttgctctgtcaaggcacagc
ctattgtctcctttgctcagtgtgacatcattcagacgcttctacagaggtgacagccca
acagattcccaaaaggacatgattgaaatccctttgcctccatggcaggagagaactgat
gaatccatagaaaccaaaagagcccgcctgctctatgagagcagaaagaggggaatgttg
gaaaactgcattcttcttagtctttttgctaaagaacatctgcagcacatgacagaaaag
cagctgaacctctatgaccgcctgattaacgagcctagtaatgactgggatatttactac
tgggccacagaagctaaaccagccccagaaatatttgaaaatgaagtcatggccctgctg
agagactttgctaaaaacaaaaacaaagagcagagactgcgtgccccagatcttgagtac
ctctttgaaaagccacgttga

DBGET integrated database retrieval system