KEGG   Homo sapiens (human): 5498
Entry
5498              CDS       T01001                                 

Gene name
PPOX, PPO, V290M, VP
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
N00602  FECH deficiency in heme biosynthesis
N00603  PPOX deficiency in heme biosynthesis
Disease
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    5498 (PPOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     5498 (PPOX)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     5498 (PPOX)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_oxidored Pyr_redox_2 FAD_binding_2
Other DBs
NCBI-GeneID: 5498
NCBI-ProteinID: NP_000300
OMIM: 600923
HGNC: 9280
Ensembl: ENSG00000143224
Vega: OTTHUMG00000034342
Pharos: P50336(Tchem)
UniProt: P50336
LinkDB
Structure
PDB: 
3NKS 4IVO 4IVM

Position
1q23.3
AA seq 477 aa
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggaggcatcagcggcttggccgccagttaccac
ctgagccgggccccctgcccccctaaggtggtcctagtggagagcagtgagcgtctggga
ggctggattcgctccgttcgaggccctaatggtgctatctttgagcttggacctcgggga
attaggccagcgggagccctaggggcccggaccttgctcctggtttctgagcttggcttg
gattcagaagtgctgcctgtccggggagaccacccagctgcccagaacaggttcctctac
gtgggcggtgccctgcatgccctacccactggcctcagggggctactccgcccttcaccc
cccttctccaaacctctgttttgggctgggctgagggagctgaccaagccccggggcaaa
gagcctgatgagactgtgcacagttttgcccagcgccgccttggacctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccatcgttccatattactgggc
ctgctgctgggggcagggcggaccccacagccagactcagcactcattcgccaggccttg
gctgagcgctggagccagtggtcacttcgtggaggtctagagatgttgcctcaggccctt
gaaacccacctgactagtaggggggtcagtgttctcagaggccagccggtctgtgggctc
agcctccaggcagaagggcgctggaaggtatctctaagggacagcagtctggaggctgac
cacgttattagtgccattccagcttcagtgctcagtgagctgctccctgctgaggctgcc
cctctggctcgtgccctgagtgccatcactgcagtgtctgtagctgtggtgaatctgcag
taccaaggagcccatctgcctgtccagggatttggacatttggtgccatcttcagaagat
ccaggagtcctgggaatcgtgtatgactcagttgctttccctgagcaggacgggagcccc
cctggcctcagagtgactgtgatgctgggaggttcctggttacagacactggaggctagt
ggctgtgtcttatctcaggagctgtttcaacagcgggcccaggaagcagctgctacacaa
ttaggactgaaggagatgccgagccactgcttggtccatctacacaagaactgcattccc
cagtatacactaggtcactggcaaaaactagagtcagctaggcaattcctgactgctcac
aggttgcccctgactctggctggagcctcctatgagggagttgctgttaatgactgtata
gagagtgggcgccaggcagcagtcagtgtcctgggcacagaacctaacagctga

DBGET integrated database retrieval system