KEGG   Homo sapiens (human): 55119
Entry
55119             CDS       T01001                                 
Symbol
PRPF38B, NET1
Name
(RefSeq) pre-mRNA processing factor 38B
  KO
K12850  pre-mRNA-splicing factor 38B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    55119 (PRPF38B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    55119 (PRPF38B)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    55119 (PRPF38B)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    55119 (PRPF38B)
SSDB
Motif
Pfam: PRP38 PRP38_assoc
Other DBs
NCBI-GeneID: 55119
NCBI-ProteinID: NP_060531
HGNC: 25512
Ensembl: ENSG00000134186
Pharos: Q5VTL8(Tdark)
UniProt: Q5VTL8
LinkDB
Position
1:108692310..108702928
AA seq 546 aa
MANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGATKPAVSGKQGNVLPLWGNEKTMNLNP
MILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVG
TGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFES
FLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIKTRPRKI
KKDGKEGAEEIDRHVERRRSRSPRRSLSPRRSPRRSRSRSHHREGHGSSSFDRELEREKE
RQRLEREAKEREKERRRSRSIDRGLERRRSRSRERHRSRSRSRDRKGDRRDRDREREKEN
ERGRRRDRDYDKERGNEREKERERSRERSKEQRSRGEVEEKKHKEDKDDRRHRDDKRDSK
KEKKHSRSRSRERKHRSRSRSRNAGKRSRSRSKEKSSKHKNESKEKSNKRSRSGSQGRTD
SVEKSKKREHSPSKEKSRKRSRSKERSHKRDHSDSKDQSDKHDRRRSQSIEQESQEKQHK
NKDETV
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggctaacaacagccccgcgctgacaggcaactcgcagccgcagcaccaggcggctgca
gctgcggctcagcaacagcagcagtgcggcggcggcggcgctaccaagccggcggtctcc
ggcaagcagggcaatgtgctcccgctctggggcaacgagaagaccatgaacctcaacccc
atgatcctgaccaacatcctgtcgtcgccttacttcaaagtacagctctacgagctcaag
acctaccacgaggtggtggacgagatctactttaaggtcacgcacgttgaaccatgggag
aaaggaagcaggaaaacagcgggccagacagggatgtgcggaggggttcgaggtgttgga
acaggaggaattgtttctacagcattttgcctgttatacaaattatttaccctgaagtta
actcgaaagcaagtgatgggtcttataacacacacagactctccatatattagagcgctt
ggatttatgtatataagatatacacagccccctacagatctgtgggactggtttgaatcc
ttccttgatgatgaagaggacctagatgtgaaggctggtggaggctgtgtaatgaccatt
ggagaaatgctacgatcttttctcacaaaactggagtggttttctaccttgtttccaaga
attccagttccagttcaaaagaatattgatcaacagattaaaacccgacctagaaaaatc
aagaaagatgggaaggaaggtgctgaggaaatagacagacatgttgaacgcagacgttca
aggtctccaaggagatctctgagtccacggaggtccccaagaaggtcaagaagtagaagt
catcatcgggagggccatgggtcttctagttttgacagagaattagaaagagagaaagaa
cgccagcgactagagcgtgaagccaaagaaagggagaaagaacggcgaagatcccgaagt
attgaccgggggttagaacgcaggcgcagcagaagtagggaaaggcatagaagtcgcagt
cgaagtcgtgataggaaaggggatagaagggacagggatcgagaaagagagaaagaaaat
gagagaggtagaagacgagatcgtgactatgataaggaaagaggaaatgaacgagaaaaa
gagagagagcgatcaagagaaaggtccaaggaacagagaagtaggggagaggtagaagag
aagaaacataaagaagacaaagatgataggcggcacagagatgacaaaagagattccaag
aaagagaaaaaacacagtagaagcagaagcagagaaaggaaacacagaagtaggagtcga
agtagaaatgcagggaaacgaagtagaagtagaagcaaagagaaatcaagtaaacataaa
aatgaaagtaaagaaaaatcaaataaacgaagtcgaagtggcagtcaaggaagaactgac
agtgttgaaaaatcaaaaaaacgggaacatagtcccagcaaagaaaaatctagaaagcgt
agtagaagcaaagaacgttcccacaaacgagatcacagtgatagtaaggaccagtcagac
aaacatgatcgtcgaaggagccaaagtatagaacaagagagccaagaaaaacagcataaa
aacaaagatgagactgtgtga

KEGG   Homo sapiens (human): 84950
Entry
84950             CDS       T01001                                 
Symbol
PRPF38A, PRP38A, Prp38
Name
(RefSeq) pre-mRNA processing factor 38A
  KO
K12849  pre-mRNA-splicing factor 38A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    84950 (PRPF38A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    84950 (PRPF38A)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    84950 (PRPF38A)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    84950 (PRPF38A)
SSDB
Motif
Pfam: PRP38 PRP38_assoc
Other DBs
NCBI-GeneID: 84950
NCBI-ProteinID: NP_116253
OMIM: 617031
HGNC: 25930
Ensembl: ENSG00000134748
Pharos: Q8NAV1(Tbio)
UniProt: Q8NAV1
Structure
LinkDB
Position
1:52404602..52420836
AA seq 312 aa
MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGV
YGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYL
EPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPR
VSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPR
RRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERS
KKSHKKSRRGNE
NT seq 939 nt   +upstreamnt  +downstreamnt
atggctaaccgtacagtgaaggatgcgcacagcatccatggcaccaaccctcaatatctg
gtggagaagatcattcgaacgcgaatctatgagtccaagtactggaaagaggagtgcttt
ggacttacagctgaacttgtagtcgataaagccatggagttaaggtttgtgggtggcgtc
tatggtggcaacataaaaccaacaccctttctgtgtttaaccttgaagatgcttcaaatt
caacccgagaaggatatcattgtagagtttatcaaaaatgaagatttcaagtatgtccgc
atgctgggggcactttacatgaggctgacaggcactgcaattgattgctacaagtacttg
gaacctttgtacaatgactatcgaaaaatcaagagccagaaccgaaatggggagtttgaa
ttgatgcatgttgatgagtttattgatgaactattgcacagtgagagagtctgtgatatc
attctgccccgactacagaaacgctatgtattagaggaagctgagcaactggagcctcga
gttagtgctctggaagaggacatggatgatgtggagtccagtgaagaggaagaagaggag
gatgagaagttggaaagagtgccatcacctgatcaccgccggagaagctaccgagacttg
gacaagccccgtcgctctcccacactgcgctacaggaggagtaggagccggtctcccaga
aggcggagtcgatctcccaaaaggagaagcccctcccctcgccgagaaaggcatcggagc
aagagtccaagacgtcaccgcagcaggtcccgagatcggcggcacagatcccgttccaag
tccccaggtcatcaccgtagtcacagacacaggagccactcaaagtctcccgaaaggtct
aagaagagccacaagaagagccggagagggaatgagtaa

DBGET integrated database retrieval system