KEGG   Homo sapiens (human): 55233
Entry
55233             CDS       T01001                                 

Gene name
MOB1A, C2orf6, MATS1, MOB1, MOBK1B, MOBKL1B, Mob4B
Definition
(RefSeq) MOB kinase activator 1A
  KO
K06685  MOB kinase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    55233 (MOB1A)
   04392 Hippo signaling pathway - multiple species
    55233 (MOB1A)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 55233
NCBI-ProteinID: NP_060691
OMIM: 609281
HGNC: 16015
Ensembl: ENSG00000114978
Vega: OTTHUMG00000152833
Pharos: Q9H8S9(Tbio)
UniProt: Q9H8S9
LinkDB
Structure
PDB: 

Position
2p13.1
AA seq 216 aa
MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVN
TVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN
TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagcttcctcttcagcagccgctcttctaaaacattcaaaccaaagaagaatatccct
gaaggatctcatcagtatgaactcttaaaacatgcagaagcaactctaggaagtgggaat
ctgagacaagctgttatgttgcctgagggagaggatctcaatgaatggattgctgtgaac
actgtggatttctttaaccagatcaacatgttatatggaactattacagaattctgcact
gaagcaagctgtccagtcatgtctgcaggtccgagatatgaatatcactgggcagatggt
actaatattaaaaagccaatcaaatgttctgcaccaaaatacattgactatttgatgact
tgggttcaagatcagcttgatgatgaaactctttttccttctaagattggtgtcccattt
cccaaaaactttatgtctgtggcaaagactattctaaagcgtctgttcagggtttatgcc
catatttatcaccagcactttgattctgtgatgcagctgcaagaggaggcccacctcaac
acctcctttaagcactttattttctttgttcaggagtttaatctgattgataggcgtgag
ctggcacctcttcaagaattaatagagaaacttggatcaaaagacagataa

KEGG   Homo sapiens (human): 92597
Entry
92597             CDS       T01001                                 

Gene name
MOB1B, MATS2, MOB4A, MOBKL1A
Definition
(RefSeq) MOB kinase activator 1B
  KO
K06685  MOB kinase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    92597 (MOB1B)
   04392 Hippo signaling pathway - multiple species
    92597 (MOB1B)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 92597
NCBI-ProteinID: NP_775739
OMIM: 609282
HGNC: 29801
Ensembl: ENSG00000173542
Vega: OTTHUMG00000160844
Pharos: Q7L9L4(Tbio)
UniProt: Q7L9L4
LinkDB
Position
4q13.3
AA seq 216 aa
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVN
TVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLN
TSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagcttcttgtttggtagtcgctcttctaaaacttttaaaccaaagaagaacattcca
gagggttctcaccagtatgagctcttaaaacacgcagaagccacacttggcagtggcaac
cttcggatggctgtcatgcttcctgaaggggaagatctcaatgaatgggttgcagttaac
actgtggatttcttcaatcagatcaacatgctttatggaactatcacagacttctgtaca
gaagagagttgtccagtgatgtcagctggcccaaaatatgagtatcattgggcagatgga
acgaacataaagaaacctattaagtgctctgcaccaaagtatattgattacttgatgact
tgggttcaggaccagttggatgatgagacgttatttccatcaaaaattggtgtcccgttc
ccaaagaatttcatgtctgtggcaaaaactatactcaaacgcctctttagggtttatgct
cacatttatcatcagcattttgaccctgtgatccagcttcaggaggaagcacatctaaat
acatctttcaagcactttattttttttgtccaggaattcaaccttattgatagaagagaa
cttgcaccactccaagaactgattgaaaaactcacctcaaaagacagataa

DBGET integrated database retrieval system