KEGG   Homo sapiens (human): 55284
Entry
55284             CDS       T01001                                 
Symbol
UBE2W, UBC-16, UBC16
Name
(RefSeq) ubiquitin conjugating enzyme E2 W
  KO
K10688  ubiquitin-conjugating enzyme E2 W [EC:2.3.2.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55284 (UBE2W)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55284 (UBE2W)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.25  N-terminal E2 ubiquitin-conjugating enzyme
     55284 (UBE2W)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   55284 (UBE2W)
SSDB
Motif
Pfam: UQ_con UEV Prok-E2_B Prok-E2_A
Other DBs
NCBI-GeneID: 55284
NCBI-ProteinID: NP_060769
OMIM: 614277
HGNC: 25616
Ensembl: ENSG00000104343
Pharos: Q96B02(Tbio)
UniProt: Q96B02
Structure
LinkDB
Position
8:complement(73780096..73878862)
AA seq 151 aa
MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKF
SSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCK
EKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcgtcaatgcagaaacgactacagaaagaactgttggctttgcaaaatgacccacct
cctggaatgaccttaaatgagaagagtgttcaaaattcaattacacagtggattgtagac
atggaaggtgcaccaggtaccttatatgaaggggaaaaatttcaacttctatttaaattt
agtagtcgatatccttttgactctcctcaggtcatgtttactggtgaaaatattcctgtt
catcctcatgtttatagcaatggtcatatctgtttatccattctaacagaagactggtcc
ccagcgctctcagtccaatcagtttgtcttagcattattagcatgctttccagctgcaag
gaaaagagacgaccaccggataattctttttatgtgcgaacatgtaacaagaatccaaag
aaaacaaaatggtggtatcatgatgatacttgttga

DBGET integrated database retrieval system