KEGG   Homo sapiens (human): 55540
Entry
55540             CDS       T01001                                 
Symbol
IL17RB, CRL4, EVI27, IL17BR, IL17RH1
Name
(RefSeq) interleukin 17 receptor B
  KO
K05165  interleukin 17 receptor B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    55540 (IL17RB)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    55540 (IL17RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    55540 (IL17RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL17 receptor family
   55540 (IL17RB)
SSDB
Motif
Pfam: SEFIR IL17R_fnIII_D1 IL17R_fnIII_D2
Other DBs
NCBI-GeneID: 55540
NCBI-ProteinID: NP_061195
OMIM: 605458
HGNC: 18015
Ensembl: ENSG00000056736
Pharos: Q9NRM6(Tbio)
UniProt: Q9NRM6
LinkDB
Position
3:53846568..53865794
AA seq 502 aa
MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATG
DYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWT
FSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLW
DPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVT
GDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLV
ATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICYFTEFLQNHCR
SEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ
DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELL
HVKQQVSAGKRSQACHDGCCSL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgtcgctcgtgctgctaagcctggccgcgctgtgcaggagcgccgtaccccgagagccg
accgttcaatgtggctctgaaactgggccatctccagagtggatgctacaacatgatcta
atccccggagacttgagggacctccgagtagaacctgttacaactagtgttgcaacaggg
gactattcaattttgatgaatgtaagctgggtactccgggcagatgccagcatccgcttg
ttgaaggccaccaagatttgtgtgacgggcaaaagcaacttccagtcctacagctgtgtg
aggtgcaattacacagaggccttccagactcagaccagaccctctggtggtaaatggaca
ttttcctacatcggcttccctgtagagctgaacacagtctatttcattggggcccataat
attcctaatgcaaatatgaatgaagatggcccttccatgtctgtgaatttcacctcacca
ggctgcctagaccacataatgaaatataaaaaaaagtgtgtcaaggccggaagcctgtgg
gatccgaacatcactgcttgtaagaagaatgaggagacagtagaagtgaacttcacaacc
actcccctgggaaacagatacatggctcttatccaacacagcactatcatcgggttttct
caggtgtttgagccacaccagaagaaacaaacgcgagcttcagtggtgattccagtgact
ggggatagtgaaggtgctacggtgcagctgactccatattttcctacttgtggcagcgac
tgcatccgacataaaggaacagttgtgctctgcccacaaacaggcgtccctttccctctg
gataacaacaaaagcaagccgggaggctggctgcctctcctcctgctgtctctgctggtg
gccacatgggtgctggtggcagggatctatctaatgtggaggcacgaaaggatcaagaag
acttccttttctaccaccacactactgccccccattaaggttcttgtggtttacccatct
gaaatatgtttccatcacacaatttgttacttcactgaatttcttcaaaaccattgcaga
agtgaggtcatccttgaaaagtggcagaaaaagaaaatagcagagatgggtccagtgcag
tggcttgccactcaaaagaaggcagcagacaaagtcgtcttccttctttccaatgacgtc
aacagtgtgtgcgatggtacctgtggcaagagcgagggcagtcccagtgagaactctcaa
gacctcttcccccttgcctttaaccttttctgcagtgatctaagaagccagattcatctg
cacaaatacgtggtggtctactttagagagattgatacaaaagacgattacaatgctctc
agtgtctgccccaagtaccacctcatgaaggatgccactgctttctgtgcagaacttctc
catgtcaagcagcaggtgtcagcaggaaaaagatcacaagcctgccacgatggctgctgc
tccttgtag

DBGET integrated database retrieval system