KEGG   Homo sapiens (human): 55733
Entry
55733             CDS       T01001                                 
Symbol
HHAT, MART2, NNMS, SKI1, Skn
Name
(RefSeq) hedgehog acyltransferase
  KO
K24678  protein-cysteine N-palmitoyltransferase HHAT [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Network
nt06501  HH signaling
  Element
N01537  Hedgehog signaling pathway, HH ligand secretion
Disease
H02479  Nivelon-Nivelon-Mabille syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    55733 (HHAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     55733 (HHAT)
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 55733
NCBI-ProteinID: NP_001116306
OMIM: 605743
HGNC: 18270
Ensembl: ENSG00000054392
Pharos: Q5VTY9(Tbio)
UniProt: Q5VTY9
Structure
LinkDB
Position
1:210327328..210676290
AA seq 493 aa
MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEW
SFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLH
TTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYY
TSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKAS
LCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKY
LVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHG
LLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFS
PQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYS
HVGIAWAQTYATD
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgctgccccgatgggaactggcactttacctacttgcctcactaggcttccacttctat
tccttctatgaagtttacaaagtctccagagaacacgaagaggagctggaccaggaattt
gagctggagactgacactttatttggaggattaaagaaggatgcgaccgactttgagtgg
agcttctggatggaatgggggaagcagtggctggtgtggcttctccttggccacatggta
gtgtctcaaatggccacactgctggcaagaaagcacagaccctggattctcatgctctat
gggatgtgggcctgctggtgtgtgctggggacccctggtgtggctatggttttgctccat
accaccatctctttctgcgtggcccagttccggtctcagctcctgacgtggctctgttct
ctcctcctcctctccacactgaggctgcagggtgtggaagaagttaagagaaggtggtac
aagacagaaaacgagtactacctgctgcagttcacgctgaccgttcgctgcctgtactac
accagcttcagcctggagctctgctggcagcagctgcctgctgcatcgacctcctactcc
tttccctggatgctggcctatgtcttttattatccagtcttacacaatgggcccatcctc
agcttctcggagttcatcaaacagatgcagcagcaggagcatgactccctgaaggccagc
ctgtgtgtcctggccctggggctgggccgccttctttgctggtggtggctggccgagctg
atggctcacctgatgtacatgcatgccatctacagcagcatccccctcctggagactgtc
tcttgttggaccttaggaggactggcgttagcccaggtgctctttttctacgtgaagtac
ttggtgctctttggcgtgcctgctctgctcatgcgcctggatggactcactccacccgcc
ctcccccgctgcgtgagcaccatgttcagtttcaccgggatgtggaggtattttgatgtt
ggactgcataatttcttaatcaggtatgtgtacattccagtgggcgggtcccagcatggc
ctgctggggacactgttttccacggcgatgacatttgcatttgtgagctactggcatggc
ggctacgactacctctggtgctgggcagcgctcaactggctgggagtcactgtggagaat
ggagtccggaggctggtggagactccctgcatccaggacagtctggcccgatacttctcc
ccacaagctcgccgtcgattccacgctgcccttgcttcttgttccacctcgatgctgatc
ctgtccaacctggtatttcttgggggcaatgaggttgggaaaacctactggaataggatc
ttcatacaaggctggccttgggtgaccctctctgtcctgggattcctgtactgctactcc
cacgtgggcattgcctgggcccagacctacgccacggactaa

DBGET integrated database retrieval system