Homo sapiens (human): 55766 Help Entry 55766             CDS       T01001                                  Symbol H2AJ, H2AFJ Name (RefSeq) histone H2A.J   KO K11251   histone H2A Organism hsa  Homo sapiens (human) Pathway hsa03082   ATP-dependent chromatin remodeling hsa04217   Necroptosis hsa04613   Neutrophil extracellular trap formation hsa05034   Alcoholism hsa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     55766 (H2AJ)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     55766 (H2AJ)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     55766 (H2AJ)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     55766 (H2AJ)   09165 Substance dependence    05034 Alcoholism     55766 (H2AJ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsa03036]     55766 (H2AJ)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     55766 (H2AJ) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     55766 (H2AJ) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    55766 (H2AJ) SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Histone_ABTB CBFD_NFYB_HMF Clp_N Motif Other DBs NCBI-GeneID:  55766 NCBI-ProteinID:  NP_808760 HGNC:  14456 Ensembl:  ENSP00000438553.1 UniProt:  Q9BTM1 Structure PDBPDBj LinkDB All DBs Position 12:14774405..14778002 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESQKTKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggtcgcgggaaacagggcggcaaagtgcgagcaaaggccaaatcccgctcctcc cgcgcgggcctgcagttcccggtgggccgagtgcacagactgctgcgcaaagggaactac gcggagcgagtgggcgccggggcgccggtgtacctggcggcggtgttggagtaccttacg gcggagatcctggagctggctggcaacgccgcgcgtgacaacaagaagaccaggataatt ccccgccacctgcagctcgccatccgcaacgacgaggagttaaacaagctgctgggcaaa gtgaccatcgctcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acggagagtcagaagacgaagagcaaatga

DBGET integrated database retrieval system