KEGG   Homo sapiens (human): 55862
Entry
55862             CDS       T01001                                 
Symbol
ECHDC1, HEL-S-76, MMCD, dJ351K20.2
Name
(RefSeq) ethylmalonyl-CoA decarboxylase 1
  KO
K18426  ethylmalonyl-CoA/methylmalonyl-CoA decarboxylase [EC:4.1.1.94 4.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    55862 (ECHDC1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.94  ethylmalonyl-CoA decarboxylase
     55862 (ECHDC1)
    4.1.1.-
     55862 (ECHDC1)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 55862
NCBI-ProteinID: NP_001132982
OMIM: 612136
HGNC: 21489
Ensembl: ENSG00000093144
Vega: OTTHUMG00000015523
Pharos: Q9NTX5(Tbio)
UniProt: Q9NTX5
LinkDB
Position
6:complement(127288712..127343609)
AA seq 307 aa
MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKE
DNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAV
KSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKI
RFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETK
SLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIA
KKGKFNK
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcattgaaacaggaaatggcgaaaagtcttttgaagacagcctctctgtctggaagg
acaaaattgctacatcaaacaggattgtcactttatagtacatcccatggattttatgag
gaagaagtgaaaaaaacacttcagcagtttcctggtggatccattgaccttcagaaggaa
gacaatggcattggcattcttactctgaacaatccaagtagaatgaatgccttttcaggt
gttatgatgctacaacttctggaaaaagtaattgaattggaaaattggacagaggggaaa
ggcctcattgtccgtggggcaaaaaatactttctcttcaggatctgatctgaatgctgtg
aaatcactaggaactccagaggatggaatggccgtatgcatgttcatgcaaaacacctta
acaagatttatgagacttcctttaataagtgttgcgctggttcaaggttgggcattgggt
ggaggagcagaatttactacagcatgtgatttcaggttaatgactccagagagtaagatc
agattcgtccacaaagagatgggcataataccaagctggggtggcaccacccggctagtt
gaaataatcggaagtagacaagctctcaaagtgttgagtggggcccttaaactggattca
aaaaatgctctaaacataggaatggttgaagaggtcttgcagtcttcagatgaaactaaa
tctctagaagaggcacaagaatggctaaagcaattcatccaagggccaccggaagtaatt
agagctttgaaaaaatctgtttgttcaggcagagagctatatttggaggaagcattacag
aacgaaagagatcttttaggaacagtttggggtgggcctgcaaatttagaggctattgct
aagaaaggaaaatttaataaataa

DBGET integrated database retrieval system