KEGG   Homo sapiens (human): 56300
Entry
56300             CDS       T01001                                 
Symbol
IL36G, IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1, IL1RP2
Name
(RefSeq) interleukin 36 gamma
  KO
K05487  interleukin 36 gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56300 (IL36G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    56300 (IL36G)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   56300 (IL36G)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 56300
NCBI-ProteinID: NP_062564
OMIM: 605542
HGNC: 15741
Ensembl: ENSG00000136688
Pharos: Q9NZH8(Tbio)
UniProt: Q9NZH8
Structure
LinkDB
Position
2:112978006..112985658
AA seq 169 aa
MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVIT
CKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFY
RAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
NT seq 510 nt   +upstreamnt  +downstreamnt
atgagaggcactccaggagacgctgatggtggaggaagggccgtctatcaatcaatgtgt
aaacctattactgggactattaatgatttgaatcagcaagtgtggacccttcagggtcag
aaccttgtggcagttccacgaagtgacagtgtgaccccagtcactgttgctgttatcaca
tgcaagtatccagaggctcttgagcaaggcagaggggatcccatttatttgggaatccag
aatccagaaatgtgtttgtattgtgagaaggttggagaacagcccacattgcagctaaaa
gagcagaagatcatggatctgtatggccaacccgagcccgtgaaacccttccttttctac
cgtgccaagactggtaggacctccacccttgagtctgtggccttcccggactggttcatt
gcctcctccaagagagaccagcccatcattctgacttcagaacttgggaagtcatacaac
actgcctttgaattaaatataaatgactga

DBGET integrated database retrieval system