Entry |
|
Symbol |
B2M, IMD43
|
Name |
(RefSeq) beta-2-microglobulin
|
KO |
|
Organism |
|
Pathway |
hsa04612 | Antigen processing and presentation |
hsa05163 | Human cytomegalovirus infection |
hsa05166 | Human T-cell leukemia virus 1 infection |
hsa05168 | Herpes simplex virus 1 infection |
hsa05170 | Human immunodeficiency virus 1 infection |
|
Network |
nt06160 Human T-cell leukemia virus 1 (HTLV-1) nt06161 Human immunodeficiency virus 1 (HIV-1) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06165 Epstein-Barr virus (EBV) nt06166 Human papillomavirus (HPV) nt06167 Human cytomegalovirus (HCMV) nt06168 Herpes simplex virus 1 (HSV-1) nt06229 MHC presentation (cancer) |
Element |
N00363 | Antigen processing and presentation by MHC class I molecules |
N00492 | HTLV-1 p12 to antigen processing and presentation by MHC class I molecules |
|
Disease |
H01303 | Hypercatabolic hypoproteinemia |
H02434 | Diffuse large B-cell lymphoma, not otherwise specified |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09150 Organismal Systems
09151 Immune system
04612 Antigen processing and presentation
567 (B2M)
09160 Human Diseases
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
567 (B2M)
05170 Human immunodeficiency virus 1 infection
567 (B2M)
05168 Herpes simplex virus 1 infection
567 (B2M)
05163 Human cytomegalovirus infection
567 (B2M)
05169 Epstein-Barr virus infection
567 (B2M)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:hsa04147]
567 (B2M)
Exosome [BR:hsa04147]
Exosomal proteins
Exosomal proteins of breast milk
567 (B2M)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
15:44711517..44718145
|
AA seq |
119 aa
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
NT seq |
360 nt +upstreamnt +downstreamnt
atgtctcgctccgtggccttagctgtgctcgcgctactctctctttctggcctggaggct
atccagcgtactccaaagattcaggtttactcacgtcatccagcagagaatggaaagtca
aatttcctgaattgctatgtgtctgggtttcatccatccgacattgaagttgacttactg
aagaatggagagagaattgaaaaagtggagcattcagacttgtctttcagcaaggactgg
tctttctatctcttgtactacactgaattcacccccactgaaaaagatgagtatgcctgc
cgtgtgaaccatgtgactttgtcacagcccaagatagttaagtgggatcgagacatgtaa |