KEGG   Homo sapiens (human): 567
Entry
567               CDS       T01001                                 
Symbol
B2M, IMD43
Name
(RefSeq) beta-2-microglobulin
  KO
K08055  beta-2-microglobulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00363  Antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00845  Familial amyloidosis
H01303  Hypercatabolic hypoproteinemia
H02434  Diffuse large B-cell lymphoma, not otherwise specified
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    567 (B2M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    567 (B2M)
   05170 Human immunodeficiency virus 1 infection
    567 (B2M)
   05168 Herpes simplex virus 1 infection
    567 (B2M)
   05163 Human cytomegalovirus infection
    567 (B2M)
   05169 Epstein-Barr virus infection
    567 (B2M)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    567 (B2M)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   567 (B2M)
SSDB
Motif
Pfam: C1-set Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 567
NCBI-ProteinID: NP_004039
OMIM: 109700
HGNC: 914
Ensembl: ENSG00000166710
Pharos: P61769(Tbio)
UniProt: P61769
Structure
LinkDB
Position
15:44711517..44718145
AA seq 119 aa
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtctcgctccgtggccttagctgtgctcgcgctactctctctttctggcctggaggct
atccagcgtactccaaagattcaggtttactcacgtcatccagcagagaatggaaagtca
aatttcctgaattgctatgtgtctgggtttcatccatccgacattgaagttgacttactg
aagaatggagagagaattgaaaaagtggagcattcagacttgtctttcagcaaggactgg
tctttctatctcttgtactacactgaattcacccccactgaaaaagatgagtatgcctgc
cgtgtgaaccatgtgactttgtcacagcccaagatagttaagtgggatcgagacatgtaa

DBGET integrated database retrieval system