KEGG   Homo sapiens (human): 57094
Entry
57094             CDS       T01001                                 
Symbol
CPA6, CPAH, ETL5, FEB11
Name
(RefSeq) carboxypeptidase A6
  KO
K08782  carboxypeptidase A6 [EC:3.4.17.1]
Organism
hsa  Homo sapiens (human)
Disease
H00783  Febrile seizures
H00809  Familial epilepsy temporal lobe (ETL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    57094 (CPA6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     57094 (CPA6)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   57094 (CPA6)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 Peptidase_C16
Other DBs
NCBI-GeneID: 57094
NCBI-ProteinID: NP_065094
OMIM: 609562
HGNC: 17245
Ensembl: ENSG00000165078
Pharos: Q8N4T0(Tbio)
UniProt: Q8N4T0
LinkDB
Position
8:complement(67422038..67746360)
AA seq 437 aa
MKCLGKRRGQAAAFLPLCWLFLKILQPGHSHLYNNRYAGDKVIRFIPKTEEEAYALKKIS
YQLKVDLWQPSSISYVSEGTVTDVHIPQNGSRALLAFLQEANIQYKVLIEDLQKTLEKGS
SLHTQRNRRSLSGYNYEVYHSLEEIQNWMHHLNKTHSGLIHMFSIGRSYEGRSLFILKLG
RRSRLKRAVWIDCGIHAREWIGPAFCQWFVKEALLTYKSDPAMRKMLNHLYFYIMPVFNV
DGYHFSWTNDRFWRKTRSRNSRFRCRGVDANRNWKVKWCDEGASMHPCDDTYCGPFPESE
PEVKAVANFLRKHRKHIRAYLSFHAYAQMLLYPYSYKYATIPNFRCVESAAYKAVNALQS
VYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFLLPEMLIKPTCTE
TMLAVKNITMHLLKKCP
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgaagtgtctcgggaagcgcaggggccaggcagctgctttcctgcctctttgctggctc
tttttgaagattctgcaaccggggcacagccacctttataacaaccgctatgctggtgat
aaagtgataagatttattcccaaaacagaagaggaagcatatgcactgaagaaaatatcc
tatcaacttaaggtggacctgtggcagcccagcagtatctcctatgtatcagagggaaca
gttactgatgtccatatcccccaaaatggttcccgagccctgttagccttcttacaggaa
gccaacatccagtacaaggtcctcatagaagatcttcagaaaacactggagaagggaagc
agcttgcacacccagagaaaccgaagatccctctctggatataattatgaagtttatcac
tccttagaagaaattcaaaattggatgcatcatctgaataaaactcactcaggcctcatt
cacatgttctctattggaagatcatatgagggaagatctctttttattttaaagctgggc
agacgatcacgactcaaaagagctgtttggatagactgtggtattcatgcaagagaatgg
attggtcctgccttttgtcagtggtttgtaaaagaagctcttctaacatataagagtgac
ccagccatgagaaaaatgttgaatcatctatatttctatatcatgcctgtgtttaacgtc
gatggataccattttagttggaccaatgatcgattttggagaaaaacaaggtcaaggaac
tcaaggtttcgctgccgtggagtggatgccaatagaaactggaaagtgaagtggtgtgat
gaaggagcttctatgcacccttgtgatgacacatactgtggcccttttccagaatctgag
ccggaagtgaaggctgtagctaacttccttcgaaaacacagaaagcacattagggcttat
ctctcctttcatgcatatgctcagatgttactgtatccctattcttacaaatatgcaaca
attcccaattttagatgtgtggaatctgcagcttataaagctgtgaatgcacttcagtca
gtatacggggtacgatacagatatggaccagcctccacaacgttgtatgtgagctctggt
agctcaatggattgggcctacaaaaatggaataccttatgcatttgctttcgaactacgt
gacactggatattttggatttttactcccagagatgctcatcaaacccacctgtacagaa
actatgctggctgtgaaaaatatcacaatgcacctgctaaagaaatgtccctga

DBGET integrated database retrieval system