KEGG   Homo sapiens (human): 5720
Entry
5720              CDS       T01001                                 

Gene name
PSME1, HEL-S-129m, IFI5111, PA28A, PA28alpha, REGalpha
Definition
(RefSeq) proteasome activator subunit 1
  KO
K06696  proteasome activator subunit 1 (PA28 alpha)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5720 (PSME1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    5720 (PSME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5720 (PSME1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    5720 (PSME1)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 5720
NCBI-ProteinID: NP_006254
OMIM: 600654
HGNC: 9568
Ensembl: ENSG00000092010
Vega: OTTHUMG00000028795
Pharos: Q06323(Tbio)
UniProt: Q06323 A0A0K0K1L8
LinkDB
Structure
PDB: 
1AVO

Position
14q12
AA seq 249 aa
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKP
RGETKGMIY
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccatgctcagggtccagcccgaggcccaagccaaggtggatgtgtttcgtgaagac
ctctgtaccaagacagagaacctgctcgggagctatttccccaagaagatttctgagctg
gatgcatttttaaaggagccagctctcaatgaagccaacttgagcaatctgaaggcccca
ttggacatcccagtgcctgatccagtcaaggagaaagagaaagaggagcggaagaaacag
caggagaaggaagacaaggatgaaaagaagaagggggaggatgaagacaaaggtcctccc
tgtggcccagtgaactgcaatgaaaagatcgtggtccttctgcagcgcttgaagcctgag
atcaaggatgtcattgagcagctcaacctggtcaccacctggttgcagctgcagatacct
cggattgaggatggtaacaattttggagtggctgtccaggagaaggtgtttgagctgatg
accagcctccacaccaagctagaaggcttccacactcaaatctctaagtatttctctgag
cgtggtgatgcagtgactaaagcagccaagcagccccatgtgggtgattatcggcagctg
gtgcacgagctggatgaggcagagtaccgggacatccggctgatggtcatggagatccgc
aatgcttatgctgtgttatatgacatcatcctgaagaacttcgagaagctcaagaagccc
aggggagaaacaaagggaatgatctattga

DBGET integrated database retrieval system