KEGG   Homo sapiens (human): 5721
Entry
5721              CDS       T01001                                 

Gene name
PSME2, PA28B, PA28beta, REGbeta
Definition
(RefSeq) proteasome activator subunit 2
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5721 (PSME2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    5721 (PSME2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5721 (PSME2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    5721 (PSME2)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 5721
NCBI-ProteinID: NP_002809
OMIM: 602161
HGNC: 9569
Ensembl: ENSG00000100911
Vega: OTTHUMG00000028797
Pharos: Q9UL46(Tbio)
UniProt: Q9UL46 Q86SZ7
LinkDB
Position
14q12
AA seq 239 aa
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSL
RAPLDIPIPDPPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCIL
VITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK
ETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccaagccgtgtggggtgcgcctgagcggggaagcccgcaaacaggtggaggtcttc
agacagaatcttttccaggaggctgaggaattcctctacagattcttgccacagaaaatc
atatacctgaatcagctcttgcaagaggactccctcaatgtggctgacttgacttccctc
cgggccccactggacatccccatcccagaccctccacccaaggatgatgagatggaaaca
gataagcaggagaagaaagaagtccataagtgtggatttctccctgggaatgagaaagtc
ctgtccctgcttgccctggttaagccagaagtctggactctcaaagagaaatgcattctg
gtgattacatggatccaacacctgatccccaagattgaagatggaaatgattttggggta
gcaatccaggagaaggtgctggagagggtgaatgccgtcaagaccaaagtggaagctttc
cagacaaccatttccaagtacttctcagaacgtggggatgctgtggccaaggcctccaag
gagactcatgtaatggattaccgggccttggtgcatgagcgagatgaggcagcctatggg
gagctcagggccatggtgctggacctgagggccttctatgctgagctttatcatatcatc
agcagcaacctggagaaaattgtcaacccaaagggtgaagaaaagccatctatgtactga

DBGET integrated database retrieval system