KEGG   Homo sapiens (human): 57467
Entry
57467             CDS       T01001                                 

Symbol
HHATL, C3orf3, GUP1, MBOAT3, MSTP002, OACT3
Name
(RefSeq) hedgehog acyltransferase like
  KO
K24679  protein-cysteine N-palmitoyltransferase HHAT-like protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    57467 (HHATL)
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 57467
NCBI-ProteinID: NP_065758
OMIM: 608116
HGNC: 13242
Ensembl: ENSG00000010282
Vega: OTTHUMG00000133043
Pharos: Q9HCP6(Tdark)
UniProt: Q9HCP6 A0A024R2R3 Q5QTR4
LinkDB
Position
3p22.1
AA seq 504 aa
MGIKTALPAAELGLYSLVLSGALAYAGRGLLEASQDGAHRKAFRESVRPGWEYIGRKMDV
ADFEWVMWFTSFRNVIIFALSGHVLFAKLCTMVAPKLRSWMYAVYGALAVMGTMGPWYLL
LLLGHCVGLYVASLLGQPWLCLGLGLASLASFKMDPLISWQSGFVTGTFDLQEVLFHGGS
SFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRR
EGELWHIRAQAGLSVVAIMAVDIFFHFFYILTIPSDLKFANRLPDSALAGLAYSNLVYDW
VKAAVLFGVVNTVACLDHLDPPQPPKCITALYVFAETHFDRGINDWLCKYVYNHIGGEHS
AVIPELAATVATFAITTLWLGPCDIVYLWSFLNCFGLNFELWMQKLAEWGPLARIEASLS
VQMSRRVRALFGAMNFWAIIMYNLVSLNSLKFTELVARRLLLTGFPQTTLSILFVTYCGV
QLVKERERTLALEEEQKQDKEKPE
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgggcatcaagacagcattgccggcggctgagctgggcctctactctctggtgctgagt
ggggccctggcctatgctggccggggcctccttgaggcttcacaagatggggcccacagg
aaggccttccgggagtctgtgcgacctggctgggagtacattggccggaagatggatgtg
gctgacttcgagtgggtgatgtggttcacctcctttcgcaacgtcatcatctttgccctc
tccggacatgtgctgtttgctaaactctgcacgatggttgccccaaagctccgctcctgg
atgtatgctgtgtacggggccttggctgtgatgggcacaatgggcccttggtacctgctg
ctgctgcttggtcactgtgtgggcctctatgtggcctcgcttttgggccagccctggctc
tgtcttggccttggcttggccagcctggcctccttcaagatggaccccctaatctcttgg
cagagcgggtttgtaacaggcacttttgatcttcaagaggtgctgtttcatgggggcagc
agcttcacagtgctgcgttgcaccagctttgcactggagagctgtgcccaccctgaccgc
cactactccttagctgacctgctcaagtacaacttctacctgcccttcttcttcttcggg
cccatcatgacctttgatcgcttccatgctcaggtgagccaggtggagccagtgagacgc
gagggtgagctgtggcacatccgagcccaggcaggcctaagcgtggtggccatcatggcc
gtcgacatcttctttcacttcttctacatcctcactatccccagcgacctcaagttcgcc
aaccgcctcccagacagtgccctcgctggcctagcctattcaaacctggtgtatgactgg
gtgaaggcggccgtcctctttggtgttgtcaacactgtggcatgcctcgaccacctggac
ccaccccagcctcccaagtgcatcaccgcactctacgtctttgcggaaacgcactttgac
cgtggcatcaacgactggctttgcaaatatgtgtataaccacattggtggggagcattcc
gctgtgatcccagagctggcagccacagtggccacatttgccatcaccacactgtggctt
gggccttgtgacattgtctacctgtggtcattccttaactgctttggcctcaactttgag
ctctggatgcaaaaactggcagagtgggggcccctagcacgaattgaggcctctctgtca
gtgcagatgtcccgtagggtccgggccctgtttggagccatgaacttctgggccatcatc
atgtacaaccttgtgagcctgaacagcctcaaattcacagagctggttgcccggcgcctg
ctactcacagggttcccccagaccacgctgtccatcctgtttgtcacctactgtggcgtc
cagctggtaaaggagcgtgagcgaaccttggcactggaggaggagcagaagcaggacaaa
gagaagccggagtag

DBGET integrated database retrieval system