KEGG   Homo sapiens (human): 57486
Entry
57486             CDS       T01001                                 

Gene name
NLN, AGTBP, EP24.16, MEP, MOP
Definition
(RefSeq) neurolysin
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    57486 (NLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    57486 (NLN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     57486 (NLN)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M3
   57486 (NLN)
SSDB
Motif
Pfam: Peptidase_M3
Other DBs
NCBI-GeneID: 57486
NCBI-ProteinID: NP_065777
OMIM: 611530
HGNC: 16058
Ensembl: ENSG00000123213
Vega: OTTHUMG00000097803
Pharos: Q9BYT8(Tbio)
UniProt: Q9BYT8
LinkDB
Structure
PDB: 
5LUZ 5LV0

Position
5q12.3
AA seq 704 aa
MIARCLLAVRSLRRVGGSRILLRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTR
TEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEVKYIVERTMLDFPQHVSSDKEVRA
ASTEADKRLSRFDIEMSMRGDIFERIVHLQETCDLGKIKPEARRYLEKSIKMGKRNGLHL
PEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYK
ITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHA
DFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWD
LYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTL
YTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPV
AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVD
SLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY
AKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgatcgcccggtgccttttggctgtgcgaagcctccgcagagttggtggttccaggatt
ttactcagaatgacgttaggaagagaagtgatgtctcctcttcaggcaatgtcttcctat
actgtggctggcagaaatgttttaagatgggatctttcaccagagcaaattaaaacaaga
actgaggagctcattgtgcagaccaaacaggtgtacgatgctgttggaatgctcggtatt
gaggaagtaacttacgagaactgtctgcaggcactggcagatgtagaagtaaagtatata
gtggaaaggaccatgctagactttccccagcatgtatcctctgacaaagaagtacgagca
gcaagtacagaagcagacaaaagactttctcgttttgatattgagatgagcatgagagga
gatatatttgagagaattgttcatttacaggaaacctgtgatctggggaagataaaacct
gaggccagacgatacttggaaaagtcaattaaaatggggaaaagaaatgggctccatctt
cctgaacaagtacagaatgaaatcaaatcaatgaagaaaagaatgagtgagctatgtatt
gattttaacaaaaacctcaatgaggatgataccttccttgtattttccaaggctgaactt
ggtgctcttcctgatgatttcattgacagtttagaaaagacagatgatgacaagtataaa
attaccttaaaatatccacactatttccctgtcatgaagaaatgttgtatccctgaaacc
agaagaaggatggaaatggcttttaatacaaggtgcaaagaggaaaacaccataattttg
cagcagctactcccactgcgaaccaaggtggccaaactactcggttatagcacacatgct
gacttcgtccttgaaatgaacactgcaaagagcacaagccgcgtaacagcctttctagat
gatttaagccagaagttaaaacccttgggtgaagcagaacgagagtttattttgaatttg
aagaaaaaggaatgcaaagacaggggttttgaatatgatgggaaaatcaatgcctgggat
ctatattactacatgactcagacagaggaactcaagtattccatagaccaagagttcctc
aaggaatacttcccaattgaggtggtcactgaaggcttgctgaacacctaccaggagttg
ttgggactttcatttgaacaaatgacagatgctcatgtttggaacaagagtgttacactt
tatactgtgaaggataaagctacaggagaagtattgggacagttctatttggacctctat
ccaagggaaggaaaatacaatcatgcggcctgcttcggtctccagcctggctgccttctg
cctgatggaagccggatgatggcagtggctgccctcgtggtgaacttctcacagccagtg
gcaggtcgtccctctctcctgagacacgacgaggtgaggacttactttcatgagtttggt
cacgtgatgcatcagatttgtgcacagactgattttgcacgatttagcggaacaaatgtg
gaaactgactttgtagaggtgccatcgcaaatgcttgaaaattgggtgtgggacgtcgat
tccctccgaagattgtcaaaacattataaagatggaagccctattgcagacgatctgctt
gaaaaacttgttgcttctaggctggtcaacacaggtcttctgaccctgcgccagattgtt
ttgagcaaagttgatcagtctcttcataccaacacatcgctggatgctgcaagtgaatat
gccaaatactgctcagaaatattaggagttgcagctactccaggcacaaatatgccagct
acctttggacatttggcagggggatacgatggccaatattatggatatctttggagtgaa
gtattttccatggatatgttttacagctgttttaaaaaagaagggataatgaatccagag
gttggaatgaaatacagaaacctaatcctgaaacctgggggatctctggacggcatggac
atgctccacaatttcttgaaacgtgagccaaaccaaaaagcgttcctaatgagtagaggc
ctgcatgctccgtga

DBGET integrated database retrieval system