KEGG   Homo sapiens (human): 57498
Entry
57498             CDS       T01001                                 

Gene name
KIDINS220, ARMS, SINO
Definition
(RefSeq) kinase D interacting substrate 220
  KO
K12460  ankyrin repeat-rich membrane spanning protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    57498 (KIDINS220)
SSDB
Motif
Pfam: KAP_NTPase Ank_2 Ank_5 Ank_4 Ank Ank_3 NACHT SAM_1
Other DBs
NCBI-GeneID: 57498
NCBI-ProteinID: NP_065789
OMIM: 615759
HGNC: 29508
Ensembl: ENSG00000134313
Vega: OTTHUMG00000151658
Pharos: Q9ULH0(Tbio)
UniProt: Q9ULH0
LinkDB
Position
2p25.1
AA seq 1771 aa
MSVLISQSVINYVEEENIPALKALLEKCKDVDERNECGQTPLMIAAEQGNLEIVKELIKN
GANCNLEDLDNWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVV
ELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARK
GHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTAL
MIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQ
DNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDKGAK
VSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILT
QIFGARHLSPTETDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLE
DEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFF
IVIYFGGRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFT
DYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSF
VIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISIASVVGLAFVLNCRTWWQVLDSLLN
SQRKRLHNAASKLHKLKSEGFMKVLKCEVELMARMAKTIDSFTQNQTRLVVIIDGLDACE
QDKVLQMLDTVRVLFSKGPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHL
PVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSKTALNR
RDTYRRRQMQRTITRQMSFDLTKLLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISF
NWDRLASWINLTEQWPYRTSWLILYLEETEGIPDQMTLKTIYERISKNIPTTKDVEPLLE
IDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYP
PLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVSPQPHSSYYSGMTGPQHPFYNRPF
FAPYLYTPRYYPGGSQHLISRPSVKTSLPRDQNNGLEVIKEDAAEGLSSPTDSSRGSGPA
PGPVVLLNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMN
MNFGDWHLFRSTVLEMRNAESHVVPEDPRFLSESSSGPAPHGEPARRASHNELPHTELSS
QTPYTLNFSFEELNTLGLDEGAPRHSNLSWQSQTRRTPSLSSLNSQDSSIEISKLTDKVQ
AEYRDAYREYIAQMSQLEGGPGSTTISGRSSPHSTYYMGQSSSGGSIHSNLEQEKGKDSE
PKPDDGRKSFLMKRGDVIDYSSSGVSTNDASPLDPITEEDEKSDQSGSKLLPGKKSSERS
SLFQTDLKLKGSGLRYQKLPSDEDESGTEESDNTPLLKDDKDRKAEGKVERVPKSPEHSA
EPIRTFIKAKEYLSDALLDKKDSSDSGVRSSESSPNHSLHNEVADDSQLEKANLIELEDD
SHSGKRGIPHSLSGLQDPIIARMSICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTP
STVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSPNPTTIQNENLKSMTHKRSQRS
SYTRLSKDPPELHAAASSESTGFGEERESIL
NT seq 5316 nt   +upstreamnt  +downstreamnt
atgtcagttttgatatcacagagcgtcataaattatgtagaggaagaaaacattcctgct
ctgaaagctcttcttgaaaaatgcaaagatgtagatgagagaaatgagtgtggccagact
ccactgatgatagctgccgaacaaggcaatctggaaatagtgaaggaattaattaagaat
ggagctaactgcaatctggaagatttggataattggacagcacttatatctgcatcgaaa
gaagggcatgtgcacatcgtagaggaactactgaaatgtggggttaacttggagcaccgt
gatatgggaggatggacagctcttatgtgggcatgttacaaaggccgtactgacgtagta
gagttgcttctttctcatggtgccaatccaagtgtcactggtctgtacagtgtttaccca
atcatttgggcagcagggagaggccatgcagatatagttcatcttttactgcaaaatggt
gctaaagtcaactgctctgataagtatggaaccacccctttagtttgggctgcacgaaag
ggtcatttggaatgtgtgaaacatttattggccatgggagctgatgtggatcaagaagga
gctaattcaatgactgcacttattgtggcagtgaaaggaggttacacacagtcagtaaaa
gaaattttgaagaggaatccaaatgtaaacttaacagataaagatggaaatacagctttg
atgattgcatcaaaggagggacatacggagattgtgcaggatctgctcgacgctggaaca
tatgtgaacatacctgacaggagtggggatactgtgttgattggcgctgtcagaggtggt
catgttgaaattgttcgagcgcttctccaaaaatatgctgatatagacattagaggacag
gataataaaactgctttgtattgggctgttgagaaaggaaatgcaacaatggtgagagat
atcttacagtgcaatcctgacactgaaatatgcacaaaggatggtgaaacgccacttata
aaggctaccaagatgagaaacattgaagtggtggagctgctgctagataaaggtgctaaa
gtgtctgctgtagataagaaaggagatactcccttgcatattgctattcgtggaaggagc
cggaaactggcagaactgcttttaagaaatcccaaagatgggcgattactttataggccc
aacaaagcaggcgagactccttataatattgactgtagccatcagaagagtattttaact
caaatatttggagccagacacttgtctcctactgaaacagacggtgacatgcttggatat
gatttatatagcagtgccctggcagatattctcagtgagcctaccatgcagccacccatt
tgtgtggggttatatgcacagtggggaagtgggaaatctttcttactcaagaaactagaa
gacgaaatgaaaaccttcgccggacaacagattgagcctctctttcagttctcatggctc
atagtgtttcttaccctgctactttgtggagggcttggtttattgtttgccttcacggtc
cacccaaatcttggaatagcagtgtcactgagcttcttggctctcttatatatattcttt
attgtcatttactttggtggacgaagagaaggagagagttggaattgggcctgggtcctc
agcactagattggcaagacatattggatatttggaactcctccttaaattgatgtttgtg
aatccacctgagttgccagagcagactactaaagctttacctgtgaggtttttgtttaca
gattacaatagactgtccagtgtaggtggagaaacttctctggctgaaatgattgcaacc
ctctcggatgcttgtgaaagagagtttggctttttggcaaccaggctttttcgagtattc
aagactgaagatactcagggtaaaaagaaatggaaaaaaacatgttgtctcccatctttt
gtcatcttcctttttatcattggctgcattatatctggaattactcttctggctatattt
agagttgacccaaagcatctgactgtaaatgctgtcctcatatcaatcgcatctgtagtg
ggattggcctttgtgttgaactgtcgtacatggtggcaagtgctggactcgctcctgaat
tcccaaagaaaacgcctccataatgcagcctccaaactgcacaaattgaaaagtgaagga
ttcatgaaagttcttaaatgtgaagtggaattgatggccaggatggcaaaaaccattgac
agcttcactcagaatcagacaaggctggtggtcatcatcgatggattagatgcctgtgag
caggacaaagtccttcagatgctggacactgtccgagttctgttttcaaaaggcccgttc
attgccatttttgcaagtgatccacatattatcataaaggcaattaaccagaacctcaat
agtgtgcttcgggattcaaatataaatggccatgactacatgcgcaacatagtccacttg
cctgtgttccttaatagtcgtggactaagcaatgcaagaaaatttctcgtaacttcagca
acaaatggagacgttccatgctcagatactacagggatacaggaagatgctgacagaaga
gtttcacagaacagccttggggagatgacaaaacttggtagcaagacagccctcaataga
cgggacacttaccgaagaaggcagatgcagaggaccatcactcgccagatgtcctttgat
cttacaaaactgctggttaccgaggactggttcagtgacatcagtccccagaccatgaga
agattacttaatattgtttctgtgacaggacgattactgagagccaatcagattagtttc
aactgggacaggcttgctagctggatcaaccttactgagcagtggccataccggacttca
tggctcatattatatttggaagagactgaaggtattccagatcaaatgacattaaaaacc
atctacgaaagaatatcaaagaatattccaacaactaaggatgttgagccacttcttgaa
attgatggagatataagaaattttgaagtgtttttgtcttcaaggaccccagttcttgtg
gctcgagatgtaaaagtctttttgccatgcactgtaaacctagatcccaaactacgggaa
attattgcagatgttcgtgctgccagagagcagatcagtattggaggactggcgtacccc
ccgctccctctacatgagggtcctcctagggcgccatcagggtacagccagcccccatcc
gtgtgctcttccacgtccttcaatgggcccttcgcaggtggagtggtgtcaccacagcct
cacagcagctattacagcggcatgacgggccctcagcatcccttctacaacaggccattc
tttgccccatacctttacacgccaaggtattaccctggcggctcccaacatctcatctca
cgtccatcagtaaaaacgagtttgcccagagatcagaacaatggcctagaagttatcaag
gaggatgctgctgaggggctttcttcacccacagactcctcgagggggtcaggcccagcc
ccaggcccagtggtattactgaattcactgaatgtggatgcagtatgtgagaagctgaaa
caaatagaagggctggaccagagtatgctgcctcagtattgtaccacgatcaaaaaggca
aacataaatggccgtgtgttagctcagtgtaacattgatgagctgaagaaagagatgaat
atgaattttggagactggcaccttttcagaagcacagtactagaaatgagaaacgcagaa
agccacgtggtccctgaagacccacgtttcctcagtgagagcagcagtggcccagccccg
cacggtgagcctgctcgccgcgcttcccacaacgagctgcctcacaccgagctctccagc
cagacgccctacacactcaacttcagcttcgaagagctgaacacgcttggcctggatgaa
ggtgcccctcgtcacagtaatctaagttggcagtcacaaactcgcagaaccccaagtctt
tcgagtctcaattcccaggattccagtattgaaatttcaaagcttactgataaggtgcag
gccgagtatagagatgcctatagagaatacattgctcagatgtcccagttagaagggggc
cccgggtctacaaccattagtggcagatcttctccacatagcacatattacatgggtcag
agttcatcagggggctctattcattcaaacctagagcaagaaaaggggaaggatagtgaa
ccaaagcccgatgatgggaggaagtcctttctaatgaagaggggagatgttatcgattat
tcatcatcaggggtttccaccaacgatgcttcccccctggatcctatcactgaagaagat
gaaaaatcagatcagtcaggcagtaagcttctcccaggcaagaaatcttccgaaaggtca
agcctcttccagacagatttgaagcttaagggaagtgggctgcgctatcaaaaactccca
agtgacgaggatgaatctggcacagaagaatcagataacactccactgctcaaagatgac
aaagacagaaaagccgaagggaaagtagagagagtgccgaagtctccagaacacagtgct
gagccgatcagaaccttcattaaagccaaagagtatttatcggatgcgctccttgacaaa
aaggattcatcggattcaggagtgagatccagtgaaagttctcccaatcactctctgcac
aatgaagtggcggatgactcccagcttgaaaaggcaaatctcatagagctggaagatgac
agtcacagcggaaagcggggaatcccacatagcctgagtggcctgcaagatccaattata
gctcggatgtccatttgttcagaagacaagaaaagcccttccgaatgcagcttgatagcc
agcagccctgaagaaaactggcctgcatgccagaaagcctacaacctgaaccgaactccc
agcaccgtgactctgaacaacaatagtgctccagccaacagagccaatcaaaatttcgat
gagatggagggaattagggagacttctcaagtcattttgaggcctagttccagtcccaac
ccaaccactattcagaatgagaatctaaaaagcatgacacataagcgaagccaacgttca
agttacacaaggctctccaaagatcctccggagctccatgcagcagcctcttctgagagc
acaggctttggagaagaaagagaaagcattctttga

DBGET integrated database retrieval system