KEGG   Homo sapiens (human): 57568
Entry
57568             CDS       T01001                                 
Symbol
SIPA1L2, SPAL2, SPAR2
Name
(RefSeq) signal induced proliferation associated 1 like 2
  KO
K17702  signal-induced proliferation-associated 1 like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    57568 (SIPA1L2)
SSDB
Motif
Pfam: SPAR_C Rap_GAP PDZ PDZ_6 bZIP_2
Other DBs
NCBI-GeneID: 57568
NCBI-ProteinID: NP_065859
OMIM: 611609
HGNC: 23800
Ensembl: ENSG00000116991
Pharos: Q9P2F8(Tdark)
UniProt: Q9P2F8
LinkDB
Position
1:complement(232397965..232630496)
AA seq 1722 aa
MSDPRQSQEEKHKLGRASSKFKDPPRIMQSDDYFARKFKAINGNMGPTTSLNASNSNETG
GGGPANGTPAVPKMGVRARVSEWPPKKDCSKELTCKALWESRSQTSYESITSVLQNGQSD
QSEGQQDEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDVTISDIDAEDVLDQNAV
NPNTGAALHREYGSTSSIDRQGLSGENFFAMLRGYRVENYDHKAMVPFGFPEFFRCDPAI
SPSLHAAAQISRGEFVRISGLDYVDSALLMGRDRDKPFKRRLKSESVETSLFRKLRTVKS
EHETFKFTSELEESRLERGIRPWNCQRCFAHYDVQSILFNINEAMATRANVGKRKNITTG
ASAASQTQMPTGQTGNCESPLGSKEDLNSKENLDADEGDGKSNDLVLSCPYFRNETGGEG
DRRIALSRANSSSFSSGESCSFESSLSSHCTNAGVSVLEVPRENQPIHREKVKRYIIEHI
DLGAYYYRKFFYGKEHQNYFGIDENLGPVAVSIRREKVEDAKEKEGSQFNYRVAFRTSEL
TTLRGAILEDAIPSTARHGTARGLPLKEVLEYVIPELSIQCLRQASNSPKVSEQLLKLDE
QGLSFQHKIGILYCKAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDNK
TDSTGTHSLYTTYKDYELMFHVSTLLPYMPNNRQQLLRKRHIGNDIVTIVFQEPGALPFT
PKSIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFL
LAKVINAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSVKFSFITLGAKKKEK
VKPRKDAHLFSIGAIMWHVIARDFGQSADIECLLGISNEFIMLIEKDSKNVVFNCSCRDV
IGWTSGLVSIKVFYERGECVLLSSVDNCAEDIREIVQRLVIVTRGCETVEMTLRRNGLGQ
LGFHVNFEGIVADVEPFGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKVV
IIQPHDDGSPRRGCSELCRIPMVEYKLDSEGTPCEYKTPFRRNTTWHRVPTPALQPLSRA
SPIPGTPDRLPCQQLLQQAQAAIPRSTSFDRKLPDGTRSSPSNQSSSSDPGPGGSGPWRP
QVGYDGCQSPLLLEHQGSGPLECDGAREREDTMEASRHPETKWHGPPSKVLGSYKERALQ
KDGSCKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIKG
ASTDSGIDTAPCMPATILGPVHLAGSRSLIHSRAEQWADAADVSGPDDEPAKLYSVHGYA
STISAGSAAEGSMGDLSEISSHSSGSHHSGSPSAHCSKSSGSLDSSKVYIVSHSSGQQVP
GSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDA
VAETQHVLSKEDFLKLMLPDSPLVEEGRRKFSFYGNLSPRRSLYRTLSDESICSNRRGSS
FGSSRSSVLDQALPNDILFSTTPPYHSTLPPRAHPAPSMGSLRNEFWFSDGSLSDKSKCA
DPGLMPLPDTATGLDWTHLVDAARAFEGLDSDEELGLLCHHTSYLDQRVASFCTLTDMQH
GQDLEGAQELPLCVDPGSGKEFMDTTGERSPSPLTGKVNQLELILRQLQTDLRKEKQDKA
VLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWFFTTIDKKS
NT seq 5169 nt   +upstreamnt  +downstreamnt
atgagtgacccaaggcagtcacaagaagagaagcacaagctaggcagagcctcttcaaag
ttcaaggatccccctagaatcatgcagtcagatgattattttgctcggaaatttaaagcc
attaatggcaacatgggacccactacttctttaaatgcctcgaattccaatgagactggc
ggtggtggtccggctaatggtaccccagctgtgcccaagatgggtgtgagagcaagggtg
tctgaatggcctcctaaaaaggactgttccaaggagctaacatgcaaggcactgtgggaa
agccggtctcagaccagttatgaaagcatcacttctgtcctgcagaatgggcagagtgac
cagagtgaaggtcagcaagatgaacagctcgatctggacttcgtggaggccaagtacaca
atcggagacatctttgtccattccccccaaagaggacttcaccccataagacagaggagc
aatagtgatgtcactatcagtgacattgatgccgaagatgtcttagaccaaaatgcagtc
aaccccaacaccggggctgccctgcacagggagtatggaagtacttcatccatcgacagg
caaggcttatctggtgaaaacttttttgctatgctcagagggtaccgagtagaaaattat
gaccacaaagcaatggtcccttttgggttccctgaatttttccgctgtgaccctgcaatc
tctccgagccttcatgcagcagcacagatttctaggggagaatttgtccgcatctcagga
ttagattatgtggacagtgccctcctgatggggagagacagggacaagcctttcaaacgg
aggttgaaatcagagtcggtggaaacatctctcttccgaaagcttcgaactgttaaaagt
gagcacgaaactttcaagttcacgtctgagctggaggagagccgactggagaggggcatt
cgcccttggaattgtcagcgatgttttgcacattatgatgtccagagcattttgtttaat
atcaacgaagccatggctacgagggctaatgtggggaaaaggaaaaacataaccactggg
gcatctgcagcatcccagactcagatgcctacgggccagacaggcaactgtgagtcccct
ttagggagcaaggaggacctcaactccaaagagaacctggatgccgatgagggtgatggg
aaaagtaacgacctcgtccttagttgtccttactttagaaatgagactggaggggaaggc
gacaggcggattgcgctctctcgagccaactcatcctctttcagttctggggaaagctgc
tctttcgaatcgtcactcagctctcactgcacaaatgcaggtgtctccgtcttggaagtg
cccagagaaaaccagcctattcacagggagaaagtgaagcgctacatcatagaacacatt
gaccttggggcctattattaccgcaaattcttctatgggaaagagcaccaaaactacttt
ggaatagatgaaaaccttggtccagtagcagtcagcatccggagagagaaggtggaagat
gccaaggagaaagaaggatcccagttcaactacagggtggctttcaggacaagtgagctt
acaacactgagaggagcaattttagaagatgctataccctctactgctaggcatggtacc
gcacgaggactacctctcaaagaagttttggaatacgtcattccagagctgagcattcag
tgtttgcgacaggcttccaactcacccaaggtctcagagcagctgctcaagcttgatgaa
caagggctgagctttcagcacaagatcgggatcctttattgcaaagcaggccagagcaca
gaggaagagatgtataacaatgagacggcgggaccagcttttgaagaattccttgatctt
ctgggccagagagtccgactgaaaggatttagtaaatatcgagctcagctagacaataag
actgattccacgggcacgcactctctctataccacatacaaagactacgaactcatgttc
cacgtgtcaaccctgcttccctacatgcccaacaacagacaacagctactgaggaaaagg
cacataggaaatgacatcgtcaccatcgtcttccaggagcctggggcacttccttttact
ccaaaaagcatccggtctcactttcagcatgtctttgtcatagtcaaagtgcataatcca
tgtaccgaaaatgtgtgttatagtgttggagtttccagatcaaaagatgtgccaccattt
ggcccaccgattcccaaaggtgtaacttttccaaagtcagccgtgttccgggacttcctt
ttagccaaagtaatcaatgcagaaaatgcagcccataaatcagaaaagtttcgagcaatg
gccactcgaacgaggcaggagtacttgaaagatctggcggagaactttgtcacaaccgcc
accgtggatacctctgtgaagttcagcttcattacgctgggtgcgaagaaaaaggagaag
gtaaagccaaggaaggatgcccacttgtttagcattggggccatcatgtggcacgtgata
gcccgggacttcggccagtctgctgacattgaatgtcttctcgggatctccaatgagttc
atcatgttgattgaaaaggattccaagaatgttgtattcaactgttcctgcagggatgtg
attgggtggacatctggattagtgagtatcaaagtgttttacgaaagaggagaatgtgtc
ctcctgtcctcggtagacaactgtgctgaagacatcagggaaattgttcagcgattagta
atagtgacgagaggctgcgagactgtggaaatgaccctgaggaggaacgggctgggccag
cttggcttccatgtgaattttgaaggaattgtcgcagatgtggaaccttttggctttgcc
tggaaggctggccttcgccaagggagccgcctcgtggagatctgcaaagtagccgtggcc
actctgacccacgagcagatgatcgacctgctccgtacttctgtgactgtgaaggtggtc
atcatccagccccatgatgacggctcgccccgaagagggtgttcagagctctgccggatc
cctatggtggaatataaactcgacagcgagggcaccccctgcgagtataaaacccccttc
aggaggaacaccacgtggcaccgggtgcccactcctgccctgcagcccctctctagagct
tcccccatccccggcacgcccgaccggctgccgtgccaacagctgctccagcaggcccag
gctgccattcctcgaagcacctccttcgaccggaagctgcccgatggcacgagaagctca
cccagcaaccagtcatcctccagcgaccctggacccggcgggagcggaccctggagacca
caagtgggctacgacgggtgccagtcccctctactgctcgaacaccagggctcaggccct
ttggaatgtgacggagccagggagagggaagacaccatggaagcaagcaggcacccggaa
accaaatggcatggcccaccttccaaagtcctgggttcctataaagaaagagctctgcag
aaagatggaagttgcaaagattcccccaataagctttctcacattggggataaaagttgc
tccagtcactccagcagcaacacgctctccagcaacacctccagcaacagtgacgacaag
cactttgggtctggcgacctgatggaccccgaattactggggctgacctacatcaaaggg
gcctccaccgacagtggcatcgacacggccccctgcatgcctgccaccatcctcggccct
gtgcacctggcaggcagcaggtccctgatccacagccgggccgagcagtgggctgatgct
gccgacgtctctgggcctgacgacgagccagccaagttatattctgtgcatggctacgcg
tccaccatctccgccggcagtgctgcggaaggcagcatgggcgatctcagtgagatatcc
tctcattccagtggttctcaccattcaggaagcccttcagctcactgttcaaaaagtagt
gggtctctggattcatccaaagtctacatcgtgtctcacagcagcggacaacaggttccc
gggtccatgtccaagccctaccacagacaaggggcagtgaacaaatatgtcatcggctgg
aagaaatcggagggcagcccaccgcccgaggagcctgaagtgactgaatgtcccgggatg
tatagtgagatggatgtcatgtccacagcaactcagcatcagacagtggtgggagatgct
gttgcagagactcaacatgttctgtctaaagaagattttctgaaattgatgcttcctgac
agccccttagtggaggaggggcgaagaaagttttcgttctatgggaacctgtctccaagg
aggtcgctttaccgcacgctgtctgacgagagcatctgcagcaacaggagggggtcctcc
tttggcagttcccggagttccgtgcttgaccaggccctgcccaacgacattctgttcagc
accaccccaccctaccacagcacgctgcctccgcgggcccaccccgcacccagcatgggg
agcctgagaaatgagttctggttctccgatgggtccttatcagataagtccaagtgcgca
gatcctggcctgatgcccctcccggacacagccacagggttagattggacccacctcgtg
gatgctgcacgggcatttgaaggtcttgactcagatgaagaactggggctgctctgtcac
cacacgtcctatctagaccagagggtggcatccttctgcaccctgacagatatgcagcat
gggcaggacctggaaggggcccaagagctgcccttatgtgtagatccaggcagtggcaaa
gagttcatggacacaactggggagcgttctccatcaccactgaccgggaaagtcaatcag
ctggaattaattcttcgacaactccagaccgaccttcggaaggaaaaacaagacaaggcc
gttctccaagcagaagtgcagcacctgagacaggacaacatgagactgcaggaggagtcc
cagaccgcgacagctcagctgcggaaattcacagaatggtttttcaccaccatcgacaaa
aaatcttag

DBGET integrated database retrieval system