KEGG   Homo sapiens (human): 5770
Entry
5770              CDS       T01001                                 
Symbol
PTPN1, PTP1B
Name
(RefSeq) protein tyrosine phosphatase non-receptor type 1
  KO
K05696  tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
hsa05208  Chemical carcinogenesis - reactive oxygen species
Drug target
Ertiprotafib: D04050
Trodusquemine: D06252
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5770 (PTPN1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5770 (PTPN1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    5770 (PTPN1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    5770 (PTPN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5770 (PTPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5770 (PTPN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5770 (PTPN1)
SSDB
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 5770
NCBI-ProteinID: NP_002818
OMIM: 176885
HGNC: 9642
Ensembl: ENSG00000196396
Pharos: P18031(Tchem)
UniProt: P18031 A8K3M3
Structure
LinkDB
Position
20:50510383..50585241
AA seq 435 aa
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggagatggaaaaggagttcgagcagatcgacaagtccgggagctgggcggccatttac
caggatatccgacatgaagccagtgacttcccatgtagagtggccaagcttcctaagaac
aaaaaccgaaataggtacagagacgtcagtccctttgaccatagtcggattaaactacat
caagaagataatgactatatcaacgctagtttgataaaaatggaagaagcccaaaggagt
tacattcttacccagggccctttgcctaacacatgcggtcacttttgggagatggtgtgg
gagcagaaaagcaggggtgtcgtcatgctcaacagagtgatggagaaaggttcgttaaaa
tgcgcacaatactggccacaaaaagaagaaaaagagatgatctttgaagacacaaatttg
aaattaacattgatctctgaagatatcaagtcatattatacagtgcgacagctagaattg
gaaaaccttacaacccaagaaactcgagagatcttacatttccactataccacatggcct
gactttggagtccctgaatcaccagcctcattcttgaactttcttttcaaagtccgagag
tcagggtcactcagcccggagcacgggcccgttgtggtgcactgcagtgcaggcatcggc
aggtctggaaccttctgtctggctgatacctgcctcttgctgatggacaagaggaaagac
ccttcttccgttgatatcaagaaagtgctgttagaaatgaggaagtttcggatggggctg
atccagacagccgaccagctgcgcttctcctacctggctgtgatcgaaggtgccaaattc
atcatgggggactcttccgtgcaggatcagtggaaggagctttcccacgaggacctggag
cccccacccgagcatatccccccacctccccggccacccaaacgaatcctggagccacac
aatgggaaatgcagggagttcttcccaaatcaccagtgggtgaaggaagagacccaggag
gataaagactgccccatcaaggaagaaaaaggaagccccttaaatgccgcaccctacggc
atcgaaagcatgagtcaagacactgaagttagaagtcgggtcgtggggggaagtcttcga
ggtgcccaggctgcctccccagccaaaggggagccgtcactgcccgagaaggacgaggac
catgcactgagttactggaagcccttcctggtcaacatgtgcgtggctacggtcctcacg
gccggcgcttacctctgctacaggttcctgttcaacagcaacacatag

DBGET integrated database retrieval system