KEGG   Homo sapiens (human): 57758
Entry
57758             CDS       T01001                                 

Gene name
SCUBE2, CEGB1, CEGF1, CEGP1, scube/You
Definition
(RefSeq) signal peptide, CUB domain and EGF like domain containing 2
  KO
K24706  signal peptide, CUB and EGF-like domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    57758 (SCUBE2)
SSDB
Motif
Pfam: FXa_inhibition cEGF Ephrin_rec_like EGF_CA EGF_3 CUB EGF hEGF
Other DBs
NCBI-GeneID: 57758
NCBI-ProteinID: NP_001317128
OMIM: 611747
HGNC: 30425
Ensembl: ENSG00000175356
Vega: OTTHUMG00000163880
Pharos: Q9NQ36(Tbio)
UniProt: Q9NQ36 B3KS09
LinkDB
Position
11p15.4
AA seq 999 aa
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADA
LCQNTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLA
HDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADGPECSCH
PQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKDT
STGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNIVGSFDCGCKKGFKLLTDEK
SCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVN
TVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKSGGGDGCFLRCHSGIHL
SSDVTTIRTSVTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQV
PGAPGRPSTPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQ
FHLQLSGMNLDVAKKPPRTSERQAESCGVGQGHAENQCVSCRAGTYYDGARERCILCPNG
TFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQ
PEAGRTSCFPCGGGLATKHQGATSFQDCETRVQCSPGHFYNTTTHRCIRCPVGTYQPEFG
KNNCVSCPGNTTTDFDGSTNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECTWTIN
PPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLW
IQFKSNEGNSARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDV
LAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
NT seq 3000 nt   +upstreamnt  +downstreamnt
atgggggtcgcgggccgcaaccgtcccggggcggcctgggcggtgctgctgctgctgctg
ctgctgccgccactgctgctgctggcgggggccgtcccgccgggtcggggccgtgccgcg
gggccgcaggaggatgtagatgagtgtgcccaagggctagatgactgccatgccgacgcc
ctgtgtcagaacacacccacctcctacaagtgctcctgcaagcctggctaccaaggggaa
ggcaggcagtgtgaggacatcgatgaatgtggaaatgagctcaatggaggctgtgtccat
gactgtttgaatattccaggcaattatcgttgcacttgttttgatggcttcatgttggct
catgacggtcataattgtcttgatgtggacgagtgcctggagaacaatggcggctgccag
catacctgtgtcaacgtcatggggagctatgagtgctgctgcaaggaggggtttttcctg
agtgacaatcagcacacctgcattcaccgctcggaagagggcctgagctgcatgaataag
gatcacggctgtagtcacatctgcaaggaggccccaaggggcagcgtcgcctgtgagtgc
aggcctggttttgagctggccaagaaccagagagactgcatcttgacctgtaaccatggg
aacggtgggtgccagcactcctgtgacgatacagccgatggcccagagtgcagctgccat
ccacagtacaagatgcacacagatgggaggagctgccttgagcgagaggacactgtcctg
gaggtgacagagagcaacaccacatcagtggtggatggggataaacgggtgaaacggcgg
ctgctcatggaaacgtgtgctgtcaacaatggaggctgtgaccgcacctgtaaggatact
tcgacaggtgtccactgcagttgtcctgttggattcactctccagttggatgggaagaca
tgtaaagatattgatgagtgccagacccgcaatggaggttgtgatcatttctgcaaaaac
atcgtgggcagttttgactgcggctgcaagaaaggatttaaattattaacagatgagaag
tcttgccaagatgtggatgagtgctctttggataggacctgtgaccacagctgcatcaac
caccctggcacatttgcttgtgcttgcaaccgagggtacaccctgtatggcttcacccac
tgtggagacaccaatgagtgcagcatcaacaacggaggctgtcagcaggtctgtgtgaac
acagtgggcagctatgaatgccagtgccaccctgggtacaagctccactggaataaaaaa
gactgtgtggaagtgaaggggctcctgcccacaagtgtgtcaccccgtgtgtccctgcac
tgcggtaagagtggtggaggagacgggtgcttcctcagatgtcactctggcattcacctc
tcttcagatgtcaccaccatcaggacaagtgtaacctttaagctaaatgaaggcaagtgt
agtttgaaaaatgctgagctgtttcccgagggtctgcgaccagcactaccagagaagcac
agctcagtaaaagagagcttccgctacgtaaaccttacatgcagctctggcaagcaagtc
ccaggagcccctggccgaccaagcacccctaaggaaatgtttatcactgttgagtttgag
cttgaaactaaccaaaaggaggtgacagcttcttgtgacctgagctgcatcgtaaagcga
accgagaagcggctccgtaaagccatccgcacgctcagaaaggccgtccacagggagcag
tttcacctccagctctcaggcatgaacctcgacgtggctaaaaagcctcccagaacatct
gaacgccaggcagagtcctgtggagtgggccagggtcatgcagaaaaccaatgtgtcagt
tgcagggctgggacctattatgatggagcacgagaacgctgcattttatgtccaaatgga
accttccaaaatgaggaaggacaaatgacttgtgaaccatgcccaagaccaggaaattct
ggggccctgaagaccccagaagcttggaatatgtctgaatgtggaggtctgtgtcaacct
ggtgaatattctgcagatggctttgcaccttgccagctctgtgccctgggcacgttccag
cctgaagctggtcgaacttcctgcttcccctgtggaggaggccttgccaccaaacatcag
ggagctacttcctttcaggactgtgaaaccagagttcaatgttcacctggacatttctac
aacaccaccactcaccgatgtattcgttgcccagtgggaacataccagcctgaatttgga
aaaaataattgtgtttcttgcccaggaaatactacgactgactttgatggctccacaaac
ataacccagtgtaaaaacagaagatgtggaggggagctgggagatttcactgggtacatt
gaatccccaaactacccaggcaattacccagccaacaccgagtgtacgtggaccatcaac
ccaccccccaagcgccgcatcctgatcgtggtccctgagatcttcctgcccatagaggac
gactgtggggactatctggtgatgcggaaaacctcttcatccaattctgtgacaacatat
gaaacctgccagacctacgaacgccccatcgccttcacctccaggtcaaagaagctgtgg
attcagttcaagtccaatgaagggaacagcgctagagggttccaggtcccatacgtgaca
tatgatgaggactaccaggaactcattgaagacatagttcgagatggcaggctctatgca
tctgagaaccatcaggaaatacttaaggataagaaacttatcaaggctctgtttgatgtc
ctggcccatccccagaactatttcaagtacacagcccaggagtcccgagagatgtttcca
agatcgttcatccgattgctacgttccaaagtgtccaggtttttgagaccttacaaatga

DBGET integrated database retrieval system