KEGG   Homo sapiens (human): 5810
Entry
5810              CDS       T01001                                 
Symbol
RAD1, HRAD1, REC1
Name
(RefSeq) RAD1 checkpoint DNA exonuclease
  KO
K02830  cell cycle checkpoint protein [EC:3.1.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5810 (RAD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5810 (RAD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     5810 (RAD1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    5810 (RAD1)
   Rad17-Mec3-Ddc1 complex
    5810 (RAD1)
SSDB
Motif
Pfam: Rad1 Pro_3_hydrox_C Receptor_IA-2
Other DBs
NCBI-GeneID: 5810
NCBI-ProteinID: NP_002844
OMIM: 603153
HGNC: 9806
Ensembl: ENSG00000113456
Pharos: O60671(Tchem)
UniProt: O60671 A0A024R045
Structure
LinkDB
Position
5:complement(34905260..34915504)
AA seq 282 aa
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLM
LFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
NT seq 849 nt   +upstreamnt  +downstreamnt
atgccccttctgacccaacagatccaagacgaggatgatcagtacagccttgtggccagc
cttgacaacgttaggaatctctccactatcttgaaagctattcatttccgagaacatgcc
acgtgtttcgcaactaaaaatggtatcaaagtaacagtggaaaatgcaaagtgtgtgcaa
gcaaatgcttttattcaggctggaatatttcaggagtttaaagttcaggaagagtctgtt
acttttcgaattaatttaactgtccttttagactgtttatctatttttggatcaagtcct
atgccagggactttaactgcacttcgaatgtgttaccaaggttatggttaccctttgatg
ctgttcctggaagaaggaggagtggtgacagtctgcaaaatcaatacacaggaacctgag
gagaccctggactttgatttctgcagcaccaatgttattaataaaattattctgcagtca
gaggggctccgtgaagcattttctgaattggatatgacgagtgaagtcctacaaattacc
atgtctcctgacaagccttatttcaggttatctacttttggaaatgcaggaagttcccac
cttgactatcccaaagattctgatttgatggaagcatttcattgtaatcagacccaagtc
aacagatacaagatttccttactgaaaccctctacaaaggcattagtcctatcttgtaag
gtatctattcggacagataacagaggcttcctttcattacagtatatgattagaaatgaa
gatggacaaatatgttttgtggaatattactgctgccctgatgaagaagttcctgaatct
gagtcttga

DBGET integrated database retrieval system