KEGG   Homo sapiens (human): 58191
Entry
58191             CDS       T01001                                 
Symbol
CXCL16, CXCLG16, SR-PSOX, SRPSOX
Name
(RefSeq) C-X-C motif chemokine ligand 16
  KO
K10035  C-X-C motif chemokine 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    58191 (CXCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    58191 (CXCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    58191 (CXCL16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   58191 (CXCL16)
SSDB
Motif
Pfam: FeThRed_A
Other DBs
NCBI-GeneID: 58191
NCBI-ProteinID: NP_001094282
OMIM: 605398
HGNC: 16642
Ensembl: ENSG00000161921
Pharos: Q9H2A7(Tbio)
UniProt: Q9H2A7
LinkDB
Position
17:complement(4733533..4739928)
AA seq 254 aa
MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRK
HLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTS
PPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLA
AGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPD
LPVHYIPVAPDSNT
NT seq 765 nt   +upstreamnt  +downstreamnt
atgggacgggacttgcggcccgggtcccgcgtgctcctgctcctgcttctgctcctgctg
gtgtacctgactcagccaggcaatggcaacgagggcagcgtcactggaagttgttattgt
ggtaaaagaatttcttccgactccccgccatcggttcagttcatgaatcgtctccggaaa
cacctgagagcttaccatcggtgtctatactacacgaggttccagctcctttcctggagc
gtgtgtgggggcaacaaggacccatgggttcaggaattgatgagctgtcttgatctcaaa
gaatgtggacatgcttactcggggattgtggcccaccagaagcatttacttcctaccagc
cccccaatttctcaggcctcagagggggcatcttcagatatccacacccctgcccagatg
ctcctgtccaccttgcagtccactcagcgccccaccctcccagtaggatcactgtcctcg
gacaaagagctcactcgtcccaatgaaaccaccattcacactgcgggccacagtctggca
gctgggcctgaggctggggagaaccagaagcagccggaaaaaaatgctggtcccacagcc
aggacatcagccacagtgccagtcctgtgcctcctggccatcatcttcatcctcaccgca
gccctttcctatgtgctgtgcaagaggaggagggggcagtcaccgcagtcctctccagat
ctgccggttcattatatacctgtggcacctgactctaatacctga

DBGET integrated database retrieval system