KEGG   Homo sapiens (human): 5893
Entry
5893              CDS       T01001                                 

Gene name
RAD52
Definition
(RefSeq) RAD52 homolog, DNA repair protein
  KO
K10873  DNA repair and recombination protein RAD52
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    5893 (RAD52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5893 (RAD52)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad52 family proteins
     5893 (RAD52)
SSDB
Motif
Pfam: Rad52_Rad22
Other DBs
NCBI-GeneID: 5893
NCBI-ProteinID: NP_001284348
OMIM: 600392
HGNC: 9824
Ensembl: ENSG00000002016
Vega: OTTHUMG00000090361
Pharos: P43351(Tbio)
UniProt: P43351 Q5DR82
LinkDB
Structure
PDB: 
5JRB 1H2I 1KN0 5XS0 5XRZ

Position
12p13.33
AA seq 418 aa
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtctgggactgaggaagcaattcttggaggacgtgacagccatcctgctgctggcggc
ggctcagtgttatgctttggacagtgccagtacacagcagaagagtaccaggccatccag
aaggccctgaggcagaggctgggcccagaatacataagtagccgcatggctggcggaggc
cagaaggtgtgctacattgagggtcatcgggtaattaatctggccaatgagatgtttggt
tacaatggctgggcacactccatcacgcagcagaatgtggattttgttgacctcaacaat
ggcaagttctacgtgggagtctgtgcatttgtgagggtccagctgaaggatggttcatat
catgaagatgttggttatggtgttagtgagggcctcaagtccaaggctttatctttggag
aaggcaaggaaggaggcggtgacagacgggctgaagcgagccctcaggagttttgggaat
gcacttggaaactgtattctggacaaagactacctgagatcactaaataagcttccacgc
cagttgcctcttgaagtggatttaactaaagcgaagagacaagatcttgaaccgtctgtg
gaggaggcaagatacaacagctgccgaccgaacatggccctgggacacccacagctgcag
caggtgacctccccttccagacccagccatgctgtgataccggcggaccaggactgcagc
tcccgaagcctgagctcatccgccgtggagagcgaggccacgcaccagcggaagctccgg
cagaagcagctgcagcagcagttccgggagcggatggagaagcagcaggttcgagtctcc
acgccgtcagctgagaagagtgaggcagcgcctccggcccctcctgtgacgcacagcact
cctgtaactgtctcagaaccactcctggagaaagacttccttgcaggagtgactcaagaa
ttaatcaagactcttgaagacaactctgaaaagtgggctgtgactcccgatgcaggggat
ggtgtggtcaagccctcgtctagagcagacccagcccagacctctgacacattagccttg
aacaaccagatggtgacccagaacaggactccacacagcgtttgccaccagaaaccacaa
gcaaaatctggatcttgggacctccaaacttatagcgctgaccaacgcacaacaggaaac
tgggaatctcataggaagagccaggacatgaagaaaaggaaatatgatccatcttaa

DBGET integrated database retrieval system