KEGG   Homo sapiens (human): 60485
Entry
60485             CDS       T01001                                 
Symbol
SAV1, SAV, WW45, WWP4
Name
(RefSeq) salvador family WW domain containing protein 1
  KO
K16686  scaffold protein salvador
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    60485 (SAV1)
   04392 Hippo signaling pathway - multiple species
    60485 (SAV1)
SSDB
Motif
Pfam: WW Nkap_C
Other DBs
NCBI-GeneID: 60485
NCBI-ProteinID: NP_068590
OMIM: 607203
HGNC: 17795
Ensembl: ENSG00000151748
Vega: OTTHUMG00000140293
Pharos: Q9H4B6(Tbio)
UniProt: Q9H4B6
Structure
LinkDB
Position
14:complement(50633580..50668306)
AA seq 383 aa
MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAF
STSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEV
SFAVENGDSGSRYYYSDNFFDGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASGI
GRVAATSLGNLTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGW
ERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPVTYQPQQTERNQSLLVPANPYH
TAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQA
LLTELENRKQRQQWYAQQHGKNF
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgctgtcccgaaagaaaaccaaaaacgaagtgtccaagccggccgaggtgcaggggaag
tacgtgaagaaggagacgtcgcctctgcttcggaatcttatgccttcattcatccggcat
ggtccaacaattccaagacgaactgatatctgtcttccagattcaagccctaatgccttt
tcaacttctggagatgtagtttcaagaaaccagagtttccttagaactccaattcaaaga
acacctcatgaaataatgagaagagaaagcaacagattatctgcaccttcttatcttgcc
agaagtctagcagatgtccctagagagtatggttcttctcagtcatttgtaacggaagtt
agttttgctgttgaaaatggagactctggttcccgatattattattcagacaattttttt
gatggtcagagaaagcggccacttggagatcgtgcacatgaagactacagatattatgaa
tacaaccatgatctcttccaaagaatgccacagaatcaggggaggcatgcttcaggtatt
gggagagttgctgctacatctttaggaaatttgactaaccatggttctgaagatttaccc
cttcctcctggctggtctgtggactggacaatgagagggagaaaatattatatagatcat
aacacaaatacaactcactggagccatcctcttgagcgagaaggacttcctcctggatgg
gaacgagttgagtcatccgaatttggaacctattatgtagatcacacaaataagaaggcc
caatacaggcatccctgtgctcctagtgtacctcggtatgatcaaccacctcctgtcaca
taccagccacagcaaactgaaagaaatcagtcccttctggtacctgcaaatccatatcat
actgcagaaattcctgactggcttcaggtttacgcacgagcccctgtgaaatatgaccac
attctgaagtgggaactcttccagctggctgacctggatacataccagggaatgctaaag
ttgctcttcatgaaagaattggagcagattgttaaaatgtatgaagcatacagacaagcc
cttcttacagagttggaaaaccgaaagcagagacagcagtggtatgcccaacaacatgga
aaaaatttttga

DBGET integrated database retrieval system