KEGG   Homo sapiens (human): 6134
Entry
6134              CDS       T01001                                 
Symbol
RPL10, AUTSX5, DXS648, DXS648E, L10, MRXS35, NOV, QM
Name
(RefSeq) ribosomal protein L10
  KO
K02866  large subunit ribosomal protein L10e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01317  Translation initiation
Disease
H00658  Syndromic X-linked mental retardation
H02111  Autism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6134 (RPL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6134 (RPL10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6134 (RPL10)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6134 (RPL10)
  Archaea
    6134 (RPL10)
SSDB
Motif
Pfam: Ribosomal_L16
Other DBs
NCBI-GeneID: 6134
NCBI-ProteinID: NP_001290553
OMIM: 312173
HGNC: 10298
Ensembl: ENSG00000147403
Pharos: P27635(Tbio)
UniProt: P27635 X5D2T3
Structure
LinkDB
Position
X:154398065..154402339
AA seq 214 aa
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFG
KPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADE
FEDMVAEKRLIPDGCGVKYIPSRGPLDKWRALHS
NT seq 645 nt   +upstreamnt  +downstreamnt
atgggccgccgccccgcccgttgttaccggtattgtaagaacaagccgtacccaaagtct
cgcttctgccgaggtgtccctgatgccaagattcgcatttttgacctggggcggaaaaag
gcaaaagtggatgagtttccgctttgtggccacatggtgtcagatgaatatgagcagctg
tcctctgaagccctggaggctgcccgaatttgtgccaataagtacatggtaaaaagttgt
ggcaaagatggcttccatatccgggtgcggctccaccccttccacgtcatccgcatcaac
aagatgttgtcctgtgctggggctgacaggctccaaacaggcatgcgaggtgcctttgga
aagccccagggcactgtggccagggttcacattggccaagttatcatgtccatccgcacc
aagctgcagaacaaggagcatgtgattgaggccctgcgcagggccaagttcaagtttcct
ggccgccagaagatccacatctcaaagaagtggggcttcaccaagttcaatgctgatgaa
tttgaagacatggtggctgaaaagcggctcatcccagatggctgtggggtcaagtacatc
cccagtcgtggccctctggacaagtggcgggccctgcactcatga

DBGET integrated database retrieval system