KEGG   Homo sapiens (human): 6181
Entry
6181              CDS       T01001                                 
Symbol
RPLP2, D11S2243E, LP2, P2, RPP2
Name
(RefSeq) ribosomal protein lateral stalk subunit P2
  KO
K02943  large subunit ribosomal protein LP2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01317  Translation initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6181 (RPLP2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6181 (RPLP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6181 (RPLP2)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6181 (RPLP2)
SSDB
Motif
Pfam: Ribosomal_60s EF-hand_14 TFIID_30kDa
Other DBs
NCBI-GeneID: 6181
NCBI-ProteinID: NP_000995
OMIM: 180530
HGNC: 10377
Ensembl: ENSG00000177600
Pharos: P05387(Tbio)
UniProt: P05387 A0A024RCA7
Structure
LinkDB
Position
11:809967..812876
AA seq 115 aa
MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG
KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
NT seq 348 nt   +upstreamnt  +downstreamnt
atgcgctacgtcgcctcctacctgctggctgccctagggggcaactcctcccccagcgcc
aaggacatcaagaagatcttggacagcgtgggtatcgaggcggacgacgaccggctcaac
aaggttatcagtgagctgaatggaaaaaacattgaagacgtcattgcccagggtattggc
aagcttgccagtgtacctgctggtggggctgtagccgtctctgctgccccaggctctgca
gcccctgctgctggttctgcccctgctgcagcagaggagaagaaagatgagaagaaggag
gagtctgaagagtcagatgatgacatgggatttggcctttttgattaa

DBGET integrated database retrieval system