Homo sapiens (human): 6237 Help Entry 6237              CDS       T01001                                  Symbol RRAS, R-Ras, RRAS1 Name (RefSeq) RAS related   KO K07829   Ras-related protein R-Ras Organism hsa  Homo sapiens (human) Pathway hsa04010   MAPK signaling pathway hsa04014   Ras signaling pathway hsa04015   Rap1 signaling pathway hsa04024   cAMP signaling pathway hsa04072   Phospholipase D signaling pathway hsa04137   Mitophagy - animal hsa04140   Autophagy - animal hsa04218   Cellular senescence hsa04360   Axon guidance hsa04371   Apelin signaling pathway hsa04625   C-type lectin receptor signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05132   Salmonella infection hsa05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     6237 (RRAS)    04014 Ras signaling pathway     6237 (RRAS)    04015 Rap1 signaling pathway     6237 (RRAS)    04371 Apelin signaling pathway     6237 (RRAS)    04072 Phospholipase D signaling pathway     6237 (RRAS)    04024 cAMP signaling pathway     6237 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6237 (RRAS)    04137 Mitophagy - animal     6237 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     6237 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     6237 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     6237 (RRAS)   09158 Development and regeneration    04360 Axon guidance     6237 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     6237 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     6237 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:hsa04031]     6237 (RRAS) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     6237 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  6237 NCBI-ProteinID:  NP_006261 OMIM:  165090 HGNC:  10447 Ensembl:  ENSG00000126458 UniProt:  P10301 Structure PDBPDBj LinkDB All DBs Position 19:complement(49635292..49640143) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaggactcctacacgaagatctgcagtgtggatggcatcccagcccggctggac atcctggacaccgcgggccaggaagagttcggggccatgagagagcagtacatgcgtgct ggccacggcttcctgctggtgttcgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagattctgcgggtcaaggaccgcgacgacttccccgttgtgttggtc gggaacaaggcagatctggagtcacagcgccaggtcccccgatcagaagcctctgccttc ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac gaggcttttgagcagctggtgcgggctgtccggaaataccaggaacaagagctcccaccg agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system