KEGG   Homo sapiens (human): 632Help
Entry
632               CDS       T01001                                 

Gene name
BGLAP, BGP, OC, OCN
Definition
(RefSeq) bone gamma-carboxyglutamate protein
  KO
K22609  osteocalcin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    632 (BGLAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 632
NCBI-ProteinID: NP_954642
OMIM: 112260
HGNC: 1043
Ensembl: ENSG00000242252
Vega: OTTHUMG00000014819
Pharos: P02818(Tbio)
UniProt: P02818
LinkDB All DBs
Position
1q22
AA seq 100 aa AA seqDB search
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgagagccctcacactcctcgccctattggccctggccgcactttgcatcgctggccag
gcaggtgcgaagcccagcggtgcagagtccagcaaaggtgcagcctttgtgtccaagcag
gagggcagcgaggtagtgaagagacccaggcgctacctgtatcaatggctgggagcccca
gtcccctacccggatcccctggagcccaggagggaggtgtgtgagctcaatccggactgt
gacgagttggctgaccacatcggctttcaggaggcctatcggcgcttctacggcccggtc
tag

DBGET integrated database retrieval system