Entry |
|
Symbol |
CCL4, ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
|
Name |
(RefSeq) C-C motif chemokine ligand 4
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04061 | Viral protein interaction with cytokine and cytokine receptor |
hsa04620 | Toll-like receptor signaling pathway |
hsa05163 | Human cytomegalovirus infection |
|
Network |
nt06124 Chemokine signaling (viruses) nt06150 Cytokine-cytokine receptor interaction (viruses) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06167 Human cytomegalovirus (HCMV) nt06224 CXCR signaling |
Element |
N00153 | CCR/CXCR-GNB/G-PI3K-RAC signaling pathway |
N00406 | HCMV US28 to GNA12/13-Rho signaling pathway |
N01196 | CCL3/4/5/8 to CCR5 signaling |
N01207 | CCL4 to HHV6 U12 signaling |
N01212 | CCL4 to HCMV US28 signaling |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04064 NF-kappa B signaling pathway
6351 (CCL4)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
6351 (CCL4)
04061 Viral protein interaction with cytokine and cytokine receptor
6351 (CCL4)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
6351 (CCL4)
04623 Cytosolic DNA-sensing pathway
6351 (CCL4)
04062 Chemokine signaling pathway
6351 (CCL4)
09160 Human Diseases
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
6351 (CCL4)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
6351 (CCL4)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Chemokines
6351 (CCL4)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
17:36103827..36105614
|
AA seq |
92 aa
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
NT seq |
279 nt +upstreamnt +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcatgctagtagctgccttctgctctcca
gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaagcaagcaagtctgtgctgatcccagtgaatcc
tgggtccaggagtacgtgtatgacctggaactgaactga |