KEGG   Homo sapiens (human): 6357
Entry
6357              CDS       T01001                                 
Symbol
CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1
Name
(RefSeq) C-C motif chemokine ligand 13
  KO
K16595  C-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6357 (CCL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6357 (CCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6357 (CCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6357 (CCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6357 (CCL13)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6357 (CCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6357 (CCL13)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6357 (CCL13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6357
NCBI-ProteinID: NP_005399
OMIM: 601391
HGNC: 10611
Ensembl: ENSG00000181374
Pharos: Q99616(Tbio)
UniProt: Q99616
Structure
LinkDB
Position
17:34356480..34358610
AA seq 98 aa
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaagtctctgcagtgcttctgtgcctgctgctcatgacagcagctttcaacccccag
ggacttgctcagccagatgcactcaacgtcccatctacttgctgcttcacatttagcagt
aagaagatctccttgcagaggctgaagagctatgtgatcaccaccagcaggtgtccccag
aaggctgtcatcttcagaaccaaactgggcaaggagatctgtgctgacccaaaggagaag
tgggtccagaattatatgaaacacctgggccggaaagctcacaccctgaagacttga

DBGET integrated database retrieval system