KEGG   Homo sapiens (human): 6360
Entry
6360              CDS       T01001                                 
Symbol
CCL16, CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4
Name
(RefSeq) C-C motif chemokine ligand 16
  KO
K21093  C-C motif chemokine 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6360 (CCL16)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6360 (CCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6360 (CCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6360 (CCL16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6360 (CCL16)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6360
NCBI-ProteinID: NP_004581
OMIM: 601394
HGNC: 10614
Ensembl: ENSG00000275152
Pharos: O15467(Tbio)
UniProt: O15467
Structure
LinkDB
Position
17:complement(35976499..35981497)
AA seq 120 aa
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNC
HLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaggtctccgaggctgccctgtctctccttgtcctcatccttatcattacttcggct
tctcgcagccagccaaaagttcctgagtgggtgaacaccccatccacctgctgcctgaag
tattatgagaaagtgttgccaaggagactagtggtgggatacagaaaggccctcaactgt
cacctgccagcaatcatcttcgtcaccaagaggaaccgagaagtctgcaccaaccccaat
gacgactgggtccaagagtacatcaaggatcccaacctacctttgctgcctaccaggaac
ttgtccacggttaaaattattacagcaaagaatggtcaaccccagctcctcaactcccag
tga

DBGET integrated database retrieval system