KEGG   Homo sapiens (human): 6362
Entry
6362              CDS       T01001                                 
Symbol
CCL18, AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
Name
(RefSeq) C-C motif chemokine ligand 18
  KO
K21094  C-C motif chemokine 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01227  HSV1 SgG1 to CCR signaling
N01228  HSV2 SgG2 to CCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6362 (CCL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6362 (CCL18)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6362 (CCL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6362 (CCL18)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6362 (CCL18)
SSDB
Motif
Pfam: IL8 DUF6211
Other DBs
NCBI-GeneID: 6362
NCBI-ProteinID: NP_002979
OMIM: 603757
HGNC: 10616
Ensembl: ENSG00000275385
Pharos: P55774(Tbio)
UniProt: P55774
Structure
LinkDB
Position
17:36064272..36072032
AA seq 89 aa
MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI
LLTKRGRQICADPNKKWVQKYISDLKLNA
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagggccttgcagctgccctccttgtcctcgtctgcaccatggccctctgctcctgt
gcacaagttggtaccaacaaagagctctgctgcctcgtctatacctcctggcagattcca
caaaagttcatagttgactattctgaaaccagcccccagtgccccaagccaggtgtcatc
ctcctaaccaagagaggccggcagatctgtgctgaccccaataagaagtgggtccagaaa
tacatcagcgacctgaagctgaatgcctga

DBGET integrated database retrieval system