KEGG   Homo sapiens (human): 6367
Entry
6367              CDS       T01001                                 
Symbol
CCL22, A-152E5.1, ABCD-1, DC/B-CK, MDC, SCYA22, STCP-1
Name
(RefSeq) C-C motif chemokine ligand 22
  KO
K21095  C-C motif chemokine 22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04625  C-type lectin receptor signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01190  CCL5/17/22 to CCR4 signaling
N01192  HSV2 SgG2 to CCR signaling
N01193  CCL17/22 to HHV7 U12 signaling
N01194  CCL17/22 to HHV7 U51 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6367 (CCL22)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6367 (CCL22)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    6367 (CCL22)
   04062 Chemokine signaling pathway
    6367 (CCL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6367 (CCL22)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6367 (CCL22)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6367
NCBI-ProteinID: NP_002981
OMIM: 602957
HGNC: 10621
Ensembl: ENSG00000102962
Pharos: O00626(Tbio)
UniProt: O00626
LinkDB
Position
16:57357909..57366189
AA seq 93 aa
MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC
PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
NT seq 282 nt   +upstreamnt  +downstreamnt
atggatcgcctacagactgcactcctggttgtcctcgtcctccttgctgtggcgcttcaa
gcaactgaggcaggcccctacggcgccaacatggaagacagcgtctgctgccgtgattac
gtccgttaccgtctgcccctgcgcgtggtgaaacacttctactggacctcagactcctgc
ccgaggcctggcgtggtgttgctaaccttcagggataaggagatctgtgccgatcccaga
gtgccctgggtgaagatgattctcaataagctgagccaatga

DBGET integrated database retrieval system