KEGG   Homo sapiens (human): 6369
Entry
6369              CDS       T01001                                 
Symbol
CCL24, Ckb-6, MPIF-2, MPIF2, SCYA24
Name
(RefSeq) C-C motif chemokine ligand 24
  KO
K21097  C-C motif chemokine 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6369 (CCL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6369 (CCL24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6369 (CCL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6369 (CCL24)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6369 (CCL24)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6369
NCBI-ProteinID: NP_002982
OMIM: 602495
HGNC: 10623
Ensembl: ENSG00000106178
Pharos: O00175(Tbio)
UniProt: O00175
Structure
LinkDB
Position
7:complement(75810825..75823372)
AA seq 119 aa
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcaggcctgatgaccatagtaaccagccttctgttccttggtgtctgtgcccaccac
atcatccctacgggctctgtggtcatcccctctccctgctgcatgttctttgtttccaag
agaattcctgagaaccgagtggtcagctaccagctgtccagcaggagcacatgcctcaag
gcaggagtgatcttcaccaccaagaagggccagcagttctgtggcgaccccaagcaggag
tgggtccagaggtacatgaagaacctggacgccaagcagaagaaggcttcccctagggcc
agggcagtggctgtcaagggccctgtccagagatatcctggcaaccaaaccacctgctaa

DBGET integrated database retrieval system