KEGG   Homo sapiens (human): 6373
Entry
6373              CDS       T01001                                 
Symbol
CXCL11, H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1
Name
(RefSeq) C-X-C motif chemokine ligand 11
  KO
K12672  C-X-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
N01244  HSV1 SgG1 to CXCR signaling
N01245  HSV2 SgG2 to CXCR signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6373 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6373 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6373 (CXCL11)
   04062 Chemokine signaling pathway
    6373 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6373 (CXCL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6373 (CXCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6373
NCBI-ProteinID: NP_005400
OMIM: 604852
HGNC: 10638
Ensembl: ENSG00000169248
Pharos: O14625(Tbio)
UniProt: O14625
Structure
LinkDB
Position
4:complement(76033682..76036070)
AA seq 94 aa
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
NT seq 285 nt   +upstreamnt  +downstreamnt
atgagtgtgaagggcatggctatagccttggctgtgatattgtgtgctacagttgttcaa
ggcttccccatgttcaaaagaggacgctgtctttgcataggccctggggtaaaagcagtg
aaagtggcagatattgagaaagcctccataatgtacccaagtaacaactgtgacaaaata
gaagtgattattaccctgaaagaaaataaaggacaacgatgcctaaatcccaaatcgaag
caagcaaggcttataatcaaaaaagttgaaagaaagaatttttaa

DBGET integrated database retrieval system